Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E1JYI9

Protein Details
Accession A0A1E1JYI9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
52-81LECESPSKKPRNVKKFKKYCGKKGKVPACCHydrophilic
NLS Segment(s)
PositionSequence
59-70KKPRNVKKFKKY
73-73K
Subcellular Location(s) mito 15, extr 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR010636  Cerato-ulmin_hydrophobin  
IPR036686  Hydrophobin_sf  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF06766  Hydrophobin_2  
Amino Acid Sequences MRFSTISVLTVAYLAATAFANPFDLETRRDKVCNKISTAQCCSVNDFGVANLECESPSKKPRNVKKFKKYCGKKGKVPACCAPSANGDGPVCTGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.06
9 0.07
10 0.09
11 0.11
12 0.14
13 0.18
14 0.21
15 0.23
16 0.26
17 0.28
18 0.34
19 0.41
20 0.42
21 0.42
22 0.46
23 0.49
24 0.52
25 0.54
26 0.49
27 0.42
28 0.39
29 0.37
30 0.3
31 0.25
32 0.19
33 0.15
34 0.11
35 0.12
36 0.11
37 0.08
38 0.08
39 0.08
40 0.07
41 0.09
42 0.11
43 0.12
44 0.2
45 0.26
46 0.31
47 0.4
48 0.51
49 0.61
50 0.7
51 0.77
52 0.81
53 0.84
54 0.88
55 0.9
56 0.89
57 0.89
58 0.89
59 0.86
60 0.83
61 0.84
62 0.83
63 0.8
64 0.77
65 0.74
66 0.67
67 0.62
68 0.55
69 0.46
70 0.42
71 0.39
72 0.34
73 0.32
74 0.27
75 0.25