FuNGI

A0A1E1K5Y7

Protein Details

Accession

A0A1E1K5Y7

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
177-196	RAEQRKRNPRGPRTYRDRED	Basic

NLS Segment(s)

Subcellular Location(s)

nucl 20, cyto_nucl 14, cyto 6

Family & Domain DBs

InterPro	View protein in InterPro IPR019416 NCBP3
Gene Ontology	GO:0003729 F:mRNA binding GO:0000340 F:RNA 7-methylguanosine cap binding
Pfam	View protein in Pfam PF10309 NCBP3

Amino Acid Sequences

MSNMDMDIEMDIDMGLTDDLGIPEIELLPDTTSFSGLQEPQPILNTPNDISDSNAHELTPSKVHLRGLDNLTDKDIRAFAAEYYGEHRLQRVEWIDDTSANIVYDTAEIAKAALMAFSAVEITDVSQIPVLQTIPAKSFPLHPNTRLEVRLAVVGDRKQAGARDRSRFYLFNPNYDRAEQRKRNPRGPRTYRDREDGGYRSQRYDDHEQQKRERDADFDASLYDDDEASLAKRSGGNYTHHRSSSNSETRRAQSTKRDKELFPERGPRSSGRLRDRSASPVRDIVGDQDLIEDRIAERRRQQQAAVSNRLAAQALKTAKQLDPDAPKELFPSKSSPSHRRSHAFDAADPADDAADLFSRIPIPLTDGSTDSRSRGGSLASRITGKGSKSSGFSIRGTAMVPPSQVFNIKGAARVKELFPATLGDNSGKELFSGRLEGRGGRRQKAEDLFS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.05
2	0.05
3	0.04
4	0.04
5	0.05
6	0.06
7	0.07
8	0.07
9	0.06
10	0.07
11	0.08
12	0.07
13	0.07
14	0.08
15	0.08
16	0.09
17	0.11
18	0.1
19	0.11
20	0.12
21	0.12
22	0.16
23	0.17
24	0.2
25	0.23
26	0.24
27	0.24
28	0.26
29	0.26
30	0.24
31	0.24
32	0.25
33	0.2
34	0.22
35	0.23
36	0.21
37	0.22
38	0.24
39	0.26
40	0.26
41	0.26
42	0.23
43	0.21
44	0.23
45	0.23
46	0.22
47	0.2
48	0.2
49	0.22
50	0.24
51	0.28
52	0.31
53	0.35
54	0.35
55	0.39
56	0.4
57	0.38
58	0.4
59	0.36
60	0.32
61	0.27
62	0.24
63	0.17
64	0.15
65	0.15
66	0.11
67	0.14
68	0.14
69	0.13
70	0.16
71	0.19
72	0.19
73	0.18
74	0.2
75	0.18
76	0.18
77	0.23
78	0.23
79	0.22
80	0.22
81	0.25
82	0.25
83	0.23
84	0.24
85	0.2
86	0.17
87	0.13
88	0.12
89	0.09
90	0.08
91	0.08
92	0.07
93	0.07
94	0.06
95	0.06
96	0.06
97	0.06
98	0.06
99	0.05
100	0.05
101	0.04
102	0.04
103	0.04
104	0.04
105	0.04
106	0.03
107	0.04
108	0.04
109	0.04
110	0.07
111	0.07
112	0.08
113	0.08
114	0.08
115	0.08
116	0.09
117	0.09
118	0.08
119	0.09
120	0.1
121	0.12
122	0.13
123	0.15
124	0.14
125	0.21
126	0.24
127	0.31
128	0.34
129	0.34
130	0.38
131	0.41
132	0.43
133	0.37
134	0.34
135	0.26
136	0.23
137	0.22
138	0.17
139	0.15
140	0.15
141	0.16
142	0.16
143	0.16
144	0.15
145	0.14
146	0.18
147	0.21
148	0.27
149	0.32
150	0.37
151	0.38
152	0.42
153	0.44
154	0.41
155	0.4
156	0.42
157	0.36
158	0.38
159	0.41
160	0.4
161	0.39
162	0.4
163	0.4
164	0.36
165	0.46
166	0.45
167	0.49
168	0.57
169	0.61
170	0.68
171	0.74
172	0.76
173	0.77
174	0.78
175	0.78
176	0.77
177	0.81
178	0.76
179	0.7
180	0.63
181	0.53
182	0.5
183	0.44
184	0.4
185	0.38
186	0.35
187	0.32
188	0.31
189	0.31
190	0.31
191	0.37
192	0.4
193	0.42
194	0.48
195	0.52
196	0.56
197	0.62
198	0.58
199	0.52
200	0.43
201	0.35
202	0.32
203	0.31
204	0.26
205	0.18
206	0.16
207	0.14
208	0.14
209	0.12
210	0.09
211	0.05
212	0.04
213	0.04
214	0.04
215	0.04
216	0.05
217	0.05
218	0.06
219	0.07
220	0.08
221	0.11
222	0.14
223	0.18
224	0.24
225	0.29
226	0.32
227	0.31
228	0.32
229	0.3
230	0.32
231	0.37
232	0.39
233	0.37
234	0.37
235	0.4
236	0.42
237	0.47
238	0.44
239	0.39
240	0.41
241	0.49
242	0.54
243	0.57
244	0.59
245	0.52
246	0.57
247	0.63
248	0.59
249	0.53
250	0.54
251	0.49
252	0.47
253	0.5
254	0.43
255	0.4
256	0.4
257	0.43
258	0.42
259	0.47
260	0.46
261	0.48
262	0.49
263	0.5
264	0.51
265	0.45
266	0.39
267	0.34
268	0.33
269	0.29
270	0.28
271	0.21
272	0.17
273	0.14
274	0.12
275	0.11
276	0.11
277	0.1
278	0.1
279	0.08
280	0.06
281	0.14
282	0.16
283	0.17
284	0.23
285	0.32
286	0.38
287	0.4
288	0.41
289	0.4
290	0.47
291	0.53
292	0.53
293	0.44
294	0.39
295	0.37
296	0.37
297	0.31
298	0.22
299	0.15
300	0.14
301	0.16
302	0.16
303	0.17
304	0.2
305	0.2
306	0.23
307	0.24
308	0.24
309	0.3
310	0.31
311	0.34
312	0.32
313	0.31
314	0.31
315	0.33
316	0.29
317	0.24
318	0.26
319	0.25
320	0.33
321	0.4
322	0.47
323	0.49
324	0.55
325	0.59
326	0.6
327	0.62
328	0.62
329	0.62
330	0.55
331	0.5
332	0.48
333	0.42
334	0.38
335	0.31
336	0.23
337	0.16
338	0.13
339	0.12
340	0.06
341	0.06
342	0.05
343	0.06
344	0.06
345	0.07
346	0.07
347	0.08
348	0.08
349	0.12
350	0.13
351	0.15
352	0.16
353	0.17
354	0.2
355	0.23
356	0.24
357	0.2
358	0.21
359	0.19
360	0.19
361	0.18
362	0.18
363	0.19
364	0.23
365	0.26
366	0.25
367	0.27
368	0.26
369	0.28
370	0.29
371	0.26
372	0.27
373	0.26
374	0.26
375	0.27
376	0.31
377	0.33
378	0.33
379	0.33
380	0.31
381	0.29
382	0.27
383	0.25
384	0.23
385	0.21
386	0.19
387	0.19
388	0.16
389	0.18
390	0.19
391	0.21
392	0.2
393	0.18
394	0.22
395	0.21
396	0.27
397	0.29
398	0.3
399	0.31
400	0.32
401	0.31
402	0.33
403	0.33
404	0.28
405	0.25
406	0.24
407	0.22
408	0.23
409	0.23
410	0.19
411	0.18
412	0.2
413	0.21
414	0.18
415	0.17
416	0.16
417	0.16
418	0.16
419	0.21
420	0.18
421	0.21
422	0.23
423	0.28
424	0.33
425	0.41
426	0.46
427	0.47
428	0.52
429	0.52
430	0.59

A0A1E1K5Y7

3D AlphaFold-predicted Structure Viewer