Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3BDM4

Protein Details
Accession G3BDM4    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
113-136ARERGFRGPKRRDNRGPRGPRDSRBasic
139-168RDPGDIRQKQRGRREPPKPKKVPKSVEDLDBasic
NLS Segment(s)
PositionSequence
110-162LPGARERGFRGPKRRDNRGPRGPRDSRDFRDPGDIRQKQRGRREPPKPKKVPK
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0051028  P:mRNA transport  
KEGG cten:CANTEDRAFT_116388  -  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MSVTEGEGIIPSYITELTSNPVIRIRNIHPELTEDDLSGLLSQISPVEFVKFDADKKSVAYCGFQENWSENNAESIKKFDGRKAMGKILIVEDPLKPKTVKSLQDRLGPLPGARERGFRGPKRRDNRGPRGPRDSRDFRDPGDIRQKQRGRREPPKPKKVPKSVEDLDRELSEYMNST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.11
5 0.16
6 0.17
7 0.17
8 0.21
9 0.21
10 0.22
11 0.28
12 0.29
13 0.34
14 0.37
15 0.37
16 0.34
17 0.35
18 0.37
19 0.36
20 0.32
21 0.22
22 0.19
23 0.18
24 0.17
25 0.14
26 0.11
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.08
35 0.08
36 0.09
37 0.13
38 0.13
39 0.15
40 0.17
41 0.18
42 0.17
43 0.19
44 0.19
45 0.18
46 0.17
47 0.17
48 0.15
49 0.18
50 0.19
51 0.18
52 0.18
53 0.18
54 0.18
55 0.17
56 0.17
57 0.12
58 0.14
59 0.15
60 0.14
61 0.12
62 0.14
63 0.14
64 0.18
65 0.19
66 0.18
67 0.24
68 0.26
69 0.31
70 0.32
71 0.33
72 0.29
73 0.29
74 0.27
75 0.22
76 0.19
77 0.14
78 0.12
79 0.1
80 0.12
81 0.12
82 0.13
83 0.12
84 0.12
85 0.19
86 0.24
87 0.31
88 0.34
89 0.42
90 0.45
91 0.51
92 0.52
93 0.46
94 0.42
95 0.35
96 0.28
97 0.25
98 0.23
99 0.21
100 0.2
101 0.21
102 0.22
103 0.3
104 0.38
105 0.4
106 0.49
107 0.54
108 0.63
109 0.68
110 0.76
111 0.77
112 0.8
113 0.83
114 0.84
115 0.84
116 0.82
117 0.84
118 0.8
119 0.74
120 0.73
121 0.7
122 0.65
123 0.63
124 0.58
125 0.49
126 0.54
127 0.51
128 0.5
129 0.52
130 0.53
131 0.5
132 0.58
133 0.63
134 0.61
135 0.71
136 0.73
137 0.72
138 0.77
139 0.84
140 0.85
141 0.9
142 0.92
143 0.92
144 0.93
145 0.93
146 0.93
147 0.91
148 0.83
149 0.82
150 0.77
151 0.75
152 0.7
153 0.63
154 0.56
155 0.47
156 0.45
157 0.36
158 0.3