Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BCI4

Protein Details
Accession G8BCI4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-122LDTLWRKRKPEGSPDRRNKRRATBasic
NLS Segment(s)
PositionSequence
105-122RKRKPEGSPDRRNKRRAT
Subcellular Location(s) nucl 25, mito_nucl 13.833, cyto_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MNMKFMQKAESTQVSDNREEQRRKIDDVSEWSLPSSSKILKLAQRKPKIEVLGYGSIMSDRNYTSRKSWIAATNKTDLNNDERYEPSRSRHKDVPNVGELDTLWRKRKPEGSPDRRNKRRAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.43
4 0.45
5 0.48
6 0.49
7 0.47
8 0.51
9 0.5
10 0.52
11 0.5
12 0.45
13 0.41
14 0.45
15 0.46
16 0.38
17 0.35
18 0.31
19 0.28
20 0.25
21 0.21
22 0.17
23 0.14
24 0.14
25 0.16
26 0.2
27 0.25
28 0.34
29 0.42
30 0.49
31 0.56
32 0.56
33 0.57
34 0.58
35 0.54
36 0.46
37 0.39
38 0.34
39 0.28
40 0.26
41 0.23
42 0.17
43 0.15
44 0.15
45 0.13
46 0.08
47 0.06
48 0.09
49 0.1
50 0.12
51 0.13
52 0.18
53 0.18
54 0.19
55 0.22
56 0.27
57 0.32
58 0.35
59 0.37
60 0.36
61 0.36
62 0.36
63 0.34
64 0.28
65 0.26
66 0.25
67 0.23
68 0.21
69 0.21
70 0.23
71 0.27
72 0.28
73 0.29
74 0.35
75 0.4
76 0.44
77 0.5
78 0.54
79 0.58
80 0.63
81 0.64
82 0.58
83 0.55
84 0.49
85 0.42
86 0.35
87 0.33
88 0.33
89 0.32
90 0.32
91 0.34
92 0.36
93 0.42
94 0.5
95 0.5
96 0.54
97 0.6
98 0.66
99 0.74
100 0.83
101 0.88
102 0.88