Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8B5E7

Protein Details
Accession G8B5E7   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ATSVPHPKIVKKYTKRFKRHHSDRYHRVAENHydrophilic
NLS Segment(s)
PositionSequence
16-19KRFK
Subcellular Location(s) mito_nucl 12.333, nucl 12, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MATSVPHPKIVKKYTKRFKRHHSDRYHRVAENWRKQKGIDSCVRRRFRGTIPQPNIGYGSNKRTKYMTPSGHKVFVVKNLKDLDVLVMHTRTYAAEIAHNVSAKNRVDIVSKAKKIGVKVTNPKGRVSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.83
3 0.88
4 0.88
5 0.9
6 0.9
7 0.91
8 0.9
9 0.9
10 0.9
11 0.9
12 0.89
13 0.84
14 0.74
15 0.68
16 0.68
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.58
24 0.53
25 0.5
26 0.48
27 0.49
28 0.55
29 0.64
30 0.68
31 0.61
32 0.58
33 0.55
34 0.52
35 0.54
36 0.53
37 0.54
38 0.55
39 0.6
40 0.56
41 0.52
42 0.48
43 0.38
44 0.32
45 0.24
46 0.27
47 0.28
48 0.28
49 0.29
50 0.29
51 0.29
52 0.32
53 0.38
54 0.38
55 0.36
56 0.43
57 0.44
58 0.45
59 0.44
60 0.38
61 0.31
62 0.32
63 0.35
64 0.28
65 0.3
66 0.3
67 0.3
68 0.28
69 0.28
70 0.2
71 0.13
72 0.14
73 0.11
74 0.1
75 0.1
76 0.1
77 0.1
78 0.08
79 0.09
80 0.09
81 0.08
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.14
88 0.15
89 0.2
90 0.19
91 0.2
92 0.19
93 0.18
94 0.2
95 0.24
96 0.32
97 0.36
98 0.37
99 0.37
100 0.39
101 0.4
102 0.4
103 0.46
104 0.44
105 0.44
106 0.52
107 0.61
108 0.66
109 0.65
110 0.64
111 0.59