Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AZR4

Protein Details
Accession H2AZR4   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNHNKERQSNQQKEKEQRTKDRILRLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
KEGG kaf:KAFR_0I00830  -  
Pfam View protein in Pfam  
PF12622  NpwBP  
Amino Acid Sequences MNHNKERQSNQQKEKEQRTKDRILRLKNASRTKLRDKIKALEVSVKTDPKRKQLLMQLQRDLEFMEQYDLGYEKQERNDNSLGKKSIFYDKDWNPDGIAPKGYRNIPHNPTTFVRKTRLTPQLSGLSNIKLPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.85
4 0.86
5 0.83
6 0.84
7 0.81
8 0.82
9 0.79
10 0.76
11 0.75
12 0.74
13 0.75
14 0.74
15 0.76
16 0.72
17 0.71
18 0.71
19 0.71
20 0.71
21 0.68
22 0.67
23 0.63
24 0.63
25 0.62
26 0.59
27 0.52
28 0.51
29 0.46
30 0.43
31 0.42
32 0.4
33 0.35
34 0.38
35 0.4
36 0.39
37 0.45
38 0.41
39 0.42
40 0.46
41 0.55
42 0.56
43 0.59
44 0.55
45 0.49
46 0.48
47 0.43
48 0.35
49 0.24
50 0.15
51 0.1
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.09
60 0.09
61 0.12
62 0.18
63 0.18
64 0.22
65 0.27
66 0.29
67 0.3
68 0.34
69 0.33
70 0.29
71 0.29
72 0.26
73 0.3
74 0.29
75 0.28
76 0.32
77 0.34
78 0.39
79 0.4
80 0.39
81 0.31
82 0.32
83 0.32
84 0.26
85 0.26
86 0.21
87 0.21
88 0.25
89 0.27
90 0.28
91 0.3
92 0.36
93 0.38
94 0.44
95 0.44
96 0.44
97 0.45
98 0.49
99 0.51
100 0.47
101 0.47
102 0.44
103 0.47
104 0.52
105 0.58
106 0.54
107 0.5
108 0.51
109 0.54
110 0.51
111 0.51
112 0.44
113 0.37
114 0.36