Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H2AVJ6

Protein Details
Accession H2AVJ6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-31EDLKVARFIKKHKKQVTNPVEDGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR036898  RNA_pol_Rpb7-like_N_sf  
IPR041901  RNAP_I_Rpa43_N  
IPR041178  RPA43_OB  
IPR045113  Rpb7-like  
IPR005576  Rpb7-like_N  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0006352  P:DNA-templated transcription initiation  
KEGG kaf:KAFR_0E02430  -  
Pfam View protein in Pfam  
PF17875  RPA43_OB  
PF03876  SHS2_Rpb7-N  
CDD cd04328  RNAP_I_Rpa43_N  
Amino Acid Sequences MAPAKRTAEDLKVARFIKKHKKQVTNPVEDGVSSCIVRVPISLYVSLAPMYLQNPLQGIMKQHLNSMVMKYNNTVGGVILGYENLKMSNEDPLNEDGKEDEKLVKISNDTPFGFTWCQVDLFVWQPQVDDVLEGYIFIQSASHIGLLIHDVFNASIKKNNIPFDWTFVQNEETSEDVENEEADADETRASTTGRSHSMGHWVDSNGERIDGKLKFTVRSVFTTGRLVSIEGTLLENPSSEKSTARSQVANLPVVSNKKIVFDEEVETENKESHKDLELSEVKEDNGAEIVYEQNSSESDASGSSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.51
4 0.55
5 0.61
6 0.67
7 0.69
8 0.78
9 0.82
10 0.89
11 0.89
12 0.87
13 0.79
14 0.71
15 0.61
16 0.5
17 0.43
18 0.34
19 0.26
20 0.16
21 0.14
22 0.13
23 0.13
24 0.14
25 0.13
26 0.12
27 0.15
28 0.17
29 0.17
30 0.16
31 0.16
32 0.16
33 0.16
34 0.13
35 0.09
36 0.09
37 0.09
38 0.11
39 0.11
40 0.11
41 0.12
42 0.13
43 0.15
44 0.15
45 0.16
46 0.17
47 0.22
48 0.22
49 0.23
50 0.24
51 0.24
52 0.23
53 0.24
54 0.27
55 0.23
56 0.23
57 0.23
58 0.23
59 0.22
60 0.21
61 0.18
62 0.11
63 0.11
64 0.1
65 0.09
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.06
73 0.06
74 0.07
75 0.14
76 0.15
77 0.15
78 0.18
79 0.2
80 0.22
81 0.21
82 0.2
83 0.14
84 0.15
85 0.15
86 0.13
87 0.12
88 0.12
89 0.13
90 0.14
91 0.14
92 0.14
93 0.18
94 0.2
95 0.22
96 0.22
97 0.23
98 0.22
99 0.24
100 0.23
101 0.19
102 0.17
103 0.13
104 0.13
105 0.11
106 0.11
107 0.09
108 0.11
109 0.12
110 0.12
111 0.11
112 0.11
113 0.1
114 0.11
115 0.1
116 0.07
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.06
135 0.05
136 0.05
137 0.05
138 0.05
139 0.07
140 0.08
141 0.07
142 0.1
143 0.11
144 0.15
145 0.19
146 0.21
147 0.2
148 0.23
149 0.23
150 0.25
151 0.26
152 0.24
153 0.21
154 0.2
155 0.21
156 0.17
157 0.17
158 0.12
159 0.1
160 0.1
161 0.1
162 0.09
163 0.08
164 0.08
165 0.07
166 0.06
167 0.05
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.06
177 0.06
178 0.08
179 0.11
180 0.14
181 0.15
182 0.16
183 0.17
184 0.25
185 0.25
186 0.24
187 0.23
188 0.2
189 0.21
190 0.21
191 0.23
192 0.14
193 0.14
194 0.13
195 0.12
196 0.18
197 0.16
198 0.17
199 0.19
200 0.2
201 0.2
202 0.22
203 0.27
204 0.24
205 0.27
206 0.3
207 0.27
208 0.28
209 0.3
210 0.28
211 0.24
212 0.22
213 0.19
214 0.15
215 0.13
216 0.11
217 0.08
218 0.09
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.1
225 0.12
226 0.11
227 0.12
228 0.15
229 0.22
230 0.28
231 0.29
232 0.29
233 0.28
234 0.35
235 0.38
236 0.37
237 0.31
238 0.27
239 0.28
240 0.3
241 0.3
242 0.26
243 0.22
244 0.22
245 0.23
246 0.23
247 0.23
248 0.22
249 0.23
250 0.22
251 0.24
252 0.22
253 0.23
254 0.21
255 0.2
256 0.18
257 0.17
258 0.17
259 0.17
260 0.21
261 0.22
262 0.21
263 0.29
264 0.33
265 0.34
266 0.36
267 0.34
268 0.29
269 0.29
270 0.28
271 0.2
272 0.15
273 0.13
274 0.1
275 0.1
276 0.11
277 0.1
278 0.11
279 0.1
280 0.1
281 0.1
282 0.13
283 0.13
284 0.11
285 0.11
286 0.11
287 0.13