Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1F5KZ48

Protein Details
Accession A0A1F5KZ48    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VPALSRVKREQLRKRRNNLLRRHNEFWLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 13.333, cyto_nucl 10.166, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MVPALSRVKREQLRKRRNNLLRRHNEFWLLYGMKSWLIMELPDGQIFTYHSHPDVLPPSKEDMNTRSKPTVVRTPRDYNSTAIAQSAGRDLPVPYAPIRENKKWDALAQHLENYRRMVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.87
4 0.89
5 0.88
6 0.87
7 0.87
8 0.87
9 0.85
10 0.81
11 0.72
12 0.67
13 0.58
14 0.49
15 0.45
16 0.35
17 0.26
18 0.23
19 0.2
20 0.16
21 0.15
22 0.13
23 0.08
24 0.07
25 0.07
26 0.07
27 0.09
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.1
34 0.11
35 0.11
36 0.11
37 0.11
38 0.12
39 0.12
40 0.14
41 0.18
42 0.19
43 0.17
44 0.18
45 0.2
46 0.2
47 0.21
48 0.21
49 0.19
50 0.25
51 0.27
52 0.29
53 0.28
54 0.28
55 0.29
56 0.32
57 0.37
58 0.35
59 0.38
60 0.41
61 0.47
62 0.48
63 0.51
64 0.48
65 0.4
66 0.37
67 0.33
68 0.26
69 0.2
70 0.18
71 0.14
72 0.13
73 0.13
74 0.09
75 0.08
76 0.08
77 0.08
78 0.1
79 0.11
80 0.13
81 0.12
82 0.16
83 0.18
84 0.26
85 0.33
86 0.37
87 0.42
88 0.44
89 0.49
90 0.47
91 0.49
92 0.46
93 0.45
94 0.47
95 0.43
96 0.46
97 0.45
98 0.46
99 0.46