Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1F5LWB6

Protein Details
Accession A0A1F5LWB6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-61IFACKKCKKCFRKDAAEFDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHILNAQVAIRSHCCRKWFDCAECHAESESHMLQKSAEMIFACKKCKKCFRKDAAEFDESDEYCPHCDNHFVIEAVEPKPSLHVEGEDARMDNRMLKDERVARDEERSLFNLRDVSDRMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.38
4 0.39
5 0.42
6 0.48
7 0.51
8 0.52
9 0.52
10 0.53
11 0.56
12 0.51
13 0.49
14 0.39
15 0.31
16 0.26
17 0.25
18 0.21
19 0.18
20 0.17
21 0.16
22 0.15
23 0.15
24 0.17
25 0.12
26 0.12
27 0.09
28 0.11
29 0.17
30 0.2
31 0.25
32 0.27
33 0.32
34 0.39
35 0.49
36 0.56
37 0.6
38 0.68
39 0.71
40 0.77
41 0.79
42 0.8
43 0.75
44 0.67
45 0.57
46 0.49
47 0.43
48 0.32
49 0.26
50 0.18
51 0.13
52 0.12
53 0.12
54 0.11
55 0.09
56 0.1
57 0.1
58 0.12
59 0.13
60 0.12
61 0.12
62 0.13
63 0.15
64 0.14
65 0.14
66 0.12
67 0.1
68 0.12
69 0.12
70 0.12
71 0.1
72 0.1
73 0.12
74 0.15
75 0.17
76 0.17
77 0.17
78 0.15
79 0.16
80 0.15
81 0.16
82 0.15
83 0.19
84 0.2
85 0.2
86 0.27
87 0.33
88 0.37
89 0.36
90 0.38
91 0.34
92 0.38
93 0.41
94 0.37
95 0.34
96 0.33
97 0.33
98 0.3
99 0.31
100 0.28
101 0.26
102 0.28