FuNGI

A0A1F5LQB4

Protein Details

Accession

A0A1F5LQB4

Localization Confidence

Medium

Confidence Score

13.1

NoLS Segment(s)

Position	Sequence	Protein Nature
80-111	DSISMKRQAYRSKDKHRRHRRRREDGTEEVGD	Basic

NLS Segment(s)

Position	Sequence
90-102	RSKDKHRRHRRRR

Subcellular Location(s)

nucl 21, cyto_nucl 14.5, cyto 6

Family & Domain DBs

InterPro	View protein in InterPro IPR028133 Dynamitin
Gene Ontology	GO:0005737 C:cytoplasm GO:0005869 C:dynactin complex GO:0007017 P:microtubule-based process
Pfam	View protein in Pfam PF04912 Dynamitin

Amino Acid Sequences

MAFNKKYAGLPDLDPSPDIYETPDLTDEASTVPPTTIRTDSDHDDAGSNSDIDREGVNADQARMHFMGAAVDARDVNFSDSISMKRQAYRSKDKHRRHRRRREDGTEEVGDLSDSEDESVERRLARLRREVEDLKVEMANRPQEQEGGNEPSHGTSGDKPGENLSDGVAELSRALDNLHASRVAATPSHSAAAVLSQKLGSDPRSAAPADAKTQPANTPSTAVSAVPPAAASSTGILSHAAAFDSRLALLETSMGISSSSNPFIADGFGQSALQPVLPSLDQLTSRLSALTGLLVGNPASGNPGAPGAVAGLTTPHLEALSARVRKLTTDAEALTTARRRAVDAAKAAHNARITSTSSETDAPASEPVPAADDEHAAKIQALYATLPTIQSLHPLLPSVLERLRSLRACHAGAAHAADSLNELEKRHAEMASEIEQWREGLTNVEEKMRQGEDALRSNVETVEPWVRDLESRLGRLEGPPGGL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.26
2	0.25
3	0.25
4	0.22
5	0.2
6	0.19
7	0.2
8	0.19
9	0.21
10	0.21
11	0.18
12	0.18
13	0.18
14	0.15
15	0.13
16	0.14
17	0.12
18	0.12
19	0.12
20	0.12
21	0.14
22	0.18
23	0.19
24	0.2
25	0.24
26	0.28
27	0.32
28	0.35
29	0.34
30	0.3
31	0.29
32	0.27
33	0.25
34	0.21
35	0.17
36	0.13
37	0.13
38	0.12
39	0.12
40	0.12
41	0.1
42	0.1
43	0.1
44	0.14
45	0.15
46	0.15
47	0.17
48	0.17
49	0.2
50	0.19
51	0.19
52	0.15
53	0.14
54	0.14
55	0.12
56	0.14
57	0.1
58	0.1
59	0.1
60	0.1
61	0.11
62	0.1
63	0.11
64	0.1
65	0.1
66	0.11
67	0.13
68	0.16
69	0.19
70	0.23
71	0.23
72	0.28
73	0.34
74	0.4
75	0.47
76	0.55
77	0.61
78	0.68
79	0.76
80	0.82
81	0.88
82	0.91
83	0.94
84	0.94
85	0.95
86	0.95
87	0.95
88	0.96
89	0.94
90	0.9
91	0.85
92	0.81
93	0.71
94	0.6
95	0.49
96	0.38
97	0.28
98	0.2
99	0.14
100	0.08
101	0.06
102	0.06
103	0.06
104	0.06
105	0.07
106	0.09
107	0.1
108	0.1
109	0.11
110	0.18
111	0.22
112	0.28
113	0.35
114	0.38
115	0.39
116	0.46
117	0.48
118	0.44
119	0.45
120	0.4
121	0.33
122	0.3
123	0.27
124	0.23
125	0.25
126	0.26
127	0.22
128	0.23
129	0.22
130	0.22
131	0.22
132	0.23
133	0.23
134	0.23
135	0.22
136	0.21
137	0.21
138	0.19
139	0.19
140	0.16
141	0.13
142	0.1
143	0.16
144	0.19
145	0.19
146	0.19
147	0.2
148	0.21
149	0.2
150	0.18
151	0.12
152	0.09
153	0.09
154	0.09
155	0.07
156	0.06
157	0.05
158	0.06
159	0.05
160	0.05
161	0.05
162	0.06
163	0.08
164	0.08
165	0.09
166	0.09
167	0.09
168	0.1
169	0.11
170	0.1
171	0.09
172	0.1
173	0.11
174	0.11
175	0.12
176	0.1
177	0.09
178	0.08
179	0.11
180	0.12
181	0.1
182	0.1
183	0.09
184	0.09
185	0.1
186	0.12
187	0.1
188	0.1
189	0.11
190	0.12
191	0.14
192	0.14
193	0.14
194	0.15
195	0.15
196	0.16
197	0.17
198	0.18
199	0.16
200	0.17
201	0.18
202	0.18
203	0.18
204	0.15
205	0.15
206	0.14
207	0.15
208	0.14
209	0.12
210	0.11
211	0.09
212	0.09
213	0.07
214	0.07
215	0.05
216	0.05
217	0.05
218	0.04
219	0.04
220	0.04
221	0.04
222	0.05
223	0.05
224	0.05
225	0.05
226	0.05
227	0.04
228	0.04
229	0.04
230	0.04
231	0.04
232	0.04
233	0.04
234	0.04
235	0.04
236	0.04
237	0.04
238	0.04
239	0.04
240	0.04
241	0.04
242	0.04
243	0.04
244	0.06
245	0.07
246	0.08
247	0.07
248	0.07
249	0.08
250	0.08
251	0.08
252	0.07
253	0.06
254	0.06
255	0.06
256	0.06
257	0.06
258	0.07
259	0.06
260	0.06
261	0.05
262	0.05
263	0.06
264	0.06
265	0.06
266	0.06
267	0.08
268	0.08
269	0.09
270	0.1
271	0.1
272	0.1
273	0.1
274	0.09
275	0.07
276	0.07
277	0.06
278	0.05
279	0.04
280	0.04
281	0.05
282	0.05
283	0.05
284	0.04
285	0.04
286	0.05
287	0.05
288	0.05
289	0.05
290	0.06
291	0.05
292	0.05
293	0.05
294	0.04
295	0.04
296	0.04
297	0.04
298	0.04
299	0.05
300	0.05
301	0.05
302	0.05
303	0.05
304	0.05
305	0.05
306	0.09
307	0.17
308	0.18
309	0.18
310	0.2
311	0.2
312	0.21
313	0.24
314	0.22
315	0.17
316	0.18
317	0.19
318	0.18
319	0.19
320	0.19
321	0.19
322	0.19
323	0.17
324	0.17
325	0.17
326	0.16
327	0.21
328	0.25
329	0.28
330	0.29
331	0.32
332	0.32
333	0.35
334	0.35
335	0.33
336	0.29
337	0.23
338	0.21
339	0.2
340	0.19
341	0.19
342	0.21
343	0.19
344	0.2
345	0.2
346	0.2
347	0.17
348	0.16
349	0.14
350	0.12
351	0.11
352	0.1
353	0.1
354	0.09
355	0.1
356	0.1
357	0.11
358	0.1
359	0.12
360	0.12
361	0.13
362	0.13
363	0.11
364	0.12
365	0.1
366	0.11
367	0.1
368	0.09
369	0.08
370	0.09
371	0.09
372	0.1
373	0.1
374	0.08
375	0.09
376	0.09
377	0.11
378	0.12
379	0.12
380	0.12
381	0.13
382	0.13
383	0.14
384	0.15
385	0.16
386	0.17
387	0.18
388	0.19
389	0.21
390	0.27
391	0.28
392	0.3
393	0.33
394	0.36
395	0.35
396	0.35
397	0.33
398	0.28
399	0.27
400	0.26
401	0.19
402	0.15
403	0.14
404	0.12
405	0.13
406	0.12
407	0.15
408	0.14
409	0.15
410	0.16
411	0.18
412	0.22
413	0.23
414	0.22
415	0.19
416	0.2
417	0.23
418	0.24
419	0.27
420	0.24
421	0.22
422	0.22
423	0.21
424	0.2
425	0.17
426	0.13
427	0.13
428	0.15
429	0.2
430	0.2
431	0.25
432	0.25
433	0.25
434	0.29
435	0.26
436	0.24
437	0.2
438	0.26
439	0.28
440	0.34
441	0.36
442	0.32
443	0.31
444	0.32
445	0.31
446	0.25
447	0.19
448	0.17
449	0.22
450	0.21
451	0.22
452	0.23
453	0.23
454	0.24
455	0.27
456	0.31
457	0.29
458	0.31
459	0.32
460	0.32
461	0.32
462	0.32
463	0.34

A0A1F5LQB4

3D AlphaFold-predicted Structure Viewer