Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RGW5

Protein Details
Accession A0A1E5RGW5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-42VYLKIKEHKIWQKLWRRKKRAIKEDTVQDFHydrophilic
NLS Segment(s)
PositionSequence
24-33QKLWRRKKRA
Subcellular Location(s) nucl 14, mito 6, cyto 4, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MVDFLILYASTSVYLKIKEHKIWQKLWRRKKRAXIKEDTVQDFPAQVEVPARKLLDSSXVFVSNSRKNIFMSLSETSSKIVSTWSLQLNHLSTSPITASTXSSITIGTTDLPNKITPNVDIFLSSFQWCAFKYGFNKIMFLPNLHAAQKLWGLVLLLASINQIKPLNVPTGFTKSVLKNTIKSLTTHHLFYDNTNKRARNLQKLKLLIMIFSNYFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.23
4 0.3
5 0.35
6 0.44
7 0.52
8 0.57
9 0.63
10 0.7
11 0.73
12 0.76
13 0.82
14 0.84
15 0.83
16 0.86
17 0.89
18 0.91
19 0.9
20 0.89
21 0.86
22 0.83
23 0.84
24 0.79
25 0.72
26 0.62
27 0.51
28 0.43
29 0.34
30 0.28
31 0.18
32 0.12
33 0.14
34 0.14
35 0.16
36 0.18
37 0.18
38 0.16
39 0.16
40 0.17
41 0.16
42 0.17
43 0.18
44 0.19
45 0.2
46 0.21
47 0.24
48 0.26
49 0.27
50 0.26
51 0.24
52 0.21
53 0.22
54 0.23
55 0.2
56 0.22
57 0.19
58 0.2
59 0.19
60 0.19
61 0.18
62 0.17
63 0.15
64 0.1
65 0.09
66 0.08
67 0.08
68 0.12
69 0.15
70 0.16
71 0.16
72 0.18
73 0.19
74 0.18
75 0.17
76 0.14
77 0.1
78 0.1
79 0.1
80 0.08
81 0.08
82 0.07
83 0.08
84 0.07
85 0.08
86 0.07
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.08
95 0.09
96 0.09
97 0.09
98 0.1
99 0.1
100 0.1
101 0.11
102 0.11
103 0.1
104 0.1
105 0.1
106 0.1
107 0.11
108 0.11
109 0.09
110 0.08
111 0.09
112 0.09
113 0.12
114 0.11
115 0.13
116 0.16
117 0.22
118 0.28
119 0.27
120 0.28
121 0.26
122 0.32
123 0.29
124 0.27
125 0.23
126 0.19
127 0.21
128 0.21
129 0.2
130 0.14
131 0.16
132 0.16
133 0.14
134 0.1
135 0.08
136 0.08
137 0.08
138 0.07
139 0.06
140 0.05
141 0.04
142 0.05
143 0.06
144 0.06
145 0.08
146 0.09
147 0.09
148 0.1
149 0.13
150 0.17
151 0.16
152 0.18
153 0.19
154 0.25
155 0.26
156 0.26
157 0.29
158 0.27
159 0.32
160 0.37
161 0.37
162 0.33
163 0.37
164 0.43
165 0.39
166 0.37
167 0.37
168 0.38
169 0.38
170 0.37
171 0.33
172 0.3
173 0.3
174 0.33
175 0.39
176 0.38
177 0.41
178 0.46
179 0.47
180 0.45
181 0.55
182 0.59
183 0.59
184 0.6
185 0.63
186 0.66
187 0.67
188 0.66
189 0.62
190 0.54
191 0.44
192 0.38
193 0.33