Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RAY5

Protein Details
Accession A0A1E5RAY5   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-30LSAAEKQKILRERRKQKFAKVGGSGRHydrophilic
NLS Segment(s)
PositionSequence
14-24LRERRKQKFAK
Subcellular Location(s) cyto 9, cyto_mito 7.833, cyto_nucl 7.333, mito 5.5, plas 5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014802  GET2  
IPR028143  Get2/sif1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0043529  C:GET complex  
GO:0000139  C:Golgi membrane  
GO:0045048  P:protein insertion into ER membrane  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MSAELSAAEKQKILRERRKQKFAKVGGSGRLNKIVGKSDSLLSTESPLDQKASLKTSSSGDNSASTTEMEQLINNVHNTPKTSNSTKNEPEIDPALKAQLDIFKQFAQQQQQEEQFAGAPGLNGSATGAGAGASGLPEMPDLFSQLAKGFPGADGTGAGSGADIFGGANPFMDAAPMVPPEVVQYHTSTLNQFKARNTFIKWVFILLPYMYFVTHPEFLATLSTENTFLIQLFSKNNFFTVLTTLEIISISLYYQFKQKLSKKTKVTATSESKILGLLKMIPEGIIPIRNLHGKVNLVFQYLDVFNLFVVDLCFCLIVMGIMTYVHNLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.69
4 0.77
5 0.86
6 0.86
7 0.87
8 0.88
9 0.85
10 0.83
11 0.8
12 0.76
13 0.73
14 0.74
15 0.69
16 0.62
17 0.59
18 0.5
19 0.44
20 0.41
21 0.4
22 0.33
23 0.32
24 0.31
25 0.28
26 0.29
27 0.28
28 0.26
29 0.19
30 0.2
31 0.17
32 0.17
33 0.16
34 0.15
35 0.16
36 0.16
37 0.18
38 0.2
39 0.23
40 0.22
41 0.22
42 0.24
43 0.24
44 0.28
45 0.27
46 0.25
47 0.23
48 0.23
49 0.22
50 0.21
51 0.19
52 0.15
53 0.13
54 0.13
55 0.13
56 0.12
57 0.11
58 0.11
59 0.13
60 0.14
61 0.14
62 0.14
63 0.14
64 0.15
65 0.18
66 0.19
67 0.23
68 0.27
69 0.32
70 0.39
71 0.42
72 0.49
73 0.5
74 0.53
75 0.52
76 0.46
77 0.44
78 0.4
79 0.36
80 0.28
81 0.25
82 0.21
83 0.17
84 0.16
85 0.14
86 0.14
87 0.15
88 0.15
89 0.17
90 0.15
91 0.17
92 0.2
93 0.24
94 0.26
95 0.28
96 0.29
97 0.33
98 0.35
99 0.34
100 0.31
101 0.27
102 0.2
103 0.17
104 0.14
105 0.09
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.02
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.05
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.07
136 0.06
137 0.05
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.04
146 0.03
147 0.03
148 0.03
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.05
164 0.05
165 0.04
166 0.05
167 0.06
168 0.07
169 0.08
170 0.08
171 0.09
172 0.1
173 0.12
174 0.12
175 0.13
176 0.16
177 0.19
178 0.21
179 0.22
180 0.22
181 0.26
182 0.29
183 0.31
184 0.31
185 0.33
186 0.32
187 0.33
188 0.31
189 0.28
190 0.25
191 0.22
192 0.2
193 0.13
194 0.12
195 0.09
196 0.09
197 0.08
198 0.07
199 0.08
200 0.1
201 0.11
202 0.11
203 0.1
204 0.1
205 0.1
206 0.11
207 0.1
208 0.08
209 0.08
210 0.08
211 0.08
212 0.08
213 0.08
214 0.08
215 0.07
216 0.08
217 0.08
218 0.09
219 0.12
220 0.15
221 0.17
222 0.17
223 0.17
224 0.17
225 0.17
226 0.16
227 0.15
228 0.14
229 0.12
230 0.13
231 0.12
232 0.11
233 0.11
234 0.09
235 0.07
236 0.06
237 0.05
238 0.09
239 0.09
240 0.1
241 0.15
242 0.18
243 0.2
244 0.3
245 0.37
246 0.44
247 0.52
248 0.61
249 0.62
250 0.68
251 0.74
252 0.73
253 0.71
254 0.7
255 0.69
256 0.63
257 0.57
258 0.5
259 0.42
260 0.35
261 0.3
262 0.21
263 0.14
264 0.13
265 0.13
266 0.13
267 0.13
268 0.11
269 0.1
270 0.12
271 0.13
272 0.13
273 0.13
274 0.14
275 0.17
276 0.21
277 0.23
278 0.23
279 0.26
280 0.26
281 0.27
282 0.32
283 0.31
284 0.29
285 0.28
286 0.25
287 0.25
288 0.22
289 0.21
290 0.14
291 0.13
292 0.11
293 0.11
294 0.11
295 0.07
296 0.08
297 0.07
298 0.07
299 0.07
300 0.07
301 0.06
302 0.07
303 0.06
304 0.05
305 0.05
306 0.05
307 0.05
308 0.06
309 0.06