Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RNZ3

Protein Details
Accession A0A1E5RNZ3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-57QQQQKSAEPKHKEKNKSKKLQGPKRDQILHydrophilic
NLS Segment(s)
PositionSequence
37-52PKHKEKNKSKKLQGPK
Subcellular Location(s) cyto 13, cyto_nucl 12.833, nucl 10.5, mito_nucl 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR044641  Lsm7/SmG-like  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0032991  C:protein-containing complex  
GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MSIQHLQDQQEEEIAAARETQVLPPLTQQQQQKSAEPKHKEKNKSKKLQGPKRDQILDLEKYKDQSVRVQLAGNITVTGVLKSYDAAMNMILDDAVEYVADELDLSKLLRKRTLGVCVVRGTLLVLVSPNYAALASSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.11
4 0.1
5 0.11
6 0.12
7 0.12
8 0.15
9 0.15
10 0.15
11 0.18
12 0.25
13 0.26
14 0.31
15 0.35
16 0.36
17 0.43
18 0.45
19 0.48
20 0.49
21 0.54
22 0.58
23 0.6
24 0.63
25 0.65
26 0.72
27 0.76
28 0.78
29 0.81
30 0.83
31 0.85
32 0.85
33 0.84
34 0.87
35 0.87
36 0.86
37 0.85
38 0.82
39 0.79
40 0.72
41 0.63
42 0.57
43 0.53
44 0.47
45 0.39
46 0.35
47 0.28
48 0.28
49 0.28
50 0.25
51 0.2
52 0.19
53 0.21
54 0.21
55 0.21
56 0.2
57 0.2
58 0.19
59 0.19
60 0.14
61 0.1
62 0.07
63 0.07
64 0.07
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.05
92 0.05
93 0.1
94 0.14
95 0.16
96 0.2
97 0.21
98 0.26
99 0.3
100 0.37
101 0.39
102 0.4
103 0.41
104 0.39
105 0.39
106 0.33
107 0.29
108 0.22
109 0.16
110 0.13
111 0.09
112 0.08
113 0.09
114 0.09
115 0.09
116 0.08
117 0.07
118 0.07