Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RVM2

Protein Details
Accession A0A1E5RVM2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-127ALKMHAKKVERLKRREKRNKALKERBasic
NLS Segment(s)
PositionSequence
84-127QRIKERREMREEKERYERLALKMHAKKVERLKRREKRNKALKER
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSAKEQIEGAADNDQAALAQGNNKSGRTWKNTSKPLKPHSQVIKNKKLSSWELKKQQRLEDQQFKQKLKELKQEKEDEKQAHVQRIKERREMREEKERYERLALKMHAKKVERLKRREKRNKALKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.08
5 0.05
6 0.1
7 0.11
8 0.16
9 0.18
10 0.18
11 0.19
12 0.25
13 0.31
14 0.34
15 0.41
16 0.45
17 0.53
18 0.62
19 0.69
20 0.71
21 0.73
22 0.72
23 0.75
24 0.68
25 0.68
26 0.68
27 0.7
28 0.71
29 0.71
30 0.75
31 0.71
32 0.69
33 0.62
34 0.57
35 0.53
36 0.53
37 0.52
38 0.51
39 0.55
40 0.6
41 0.65
42 0.64
43 0.64
44 0.62
45 0.61
46 0.61
47 0.61
48 0.58
49 0.6
50 0.62
51 0.58
52 0.51
53 0.48
54 0.46
55 0.41
56 0.47
57 0.46
58 0.47
59 0.53
60 0.59
61 0.57
62 0.56
63 0.57
64 0.49
65 0.45
66 0.47
67 0.44
68 0.45
69 0.45
70 0.43
71 0.45
72 0.52
73 0.54
74 0.54
75 0.57
76 0.55
77 0.62
78 0.64
79 0.62
80 0.64
81 0.62
82 0.59
83 0.63
84 0.59
85 0.52
86 0.53
87 0.51
88 0.44
89 0.49
90 0.46
91 0.46
92 0.51
93 0.54
94 0.54
95 0.51
96 0.55
97 0.58
98 0.66
99 0.65
100 0.69
101 0.74
102 0.76
103 0.86
104 0.89
105 0.89
106 0.9
107 0.91