Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RAS1

Protein Details
Accession A0A1E5RAS1   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
269-288KKLYTFKKQYLNKSKKQNFVHydrophilic
360-384QVEPAKKWIRNLNKRCNNKETLRNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002376  Formyl_transf_N  
IPR036477  Formyl_transf_N_sf  
Gene Ontology GO:0016740  F:transferase activity  
GO:0009058  P:biosynthetic process  
Pfam View protein in Pfam  
PF00551  Formyl_trans_N  
Amino Acid Sequences MRVLFFGSDTFSIRALNVLRKNNKGYTFDIVTPEIKKYGRNLDKLSIPSIHTYCEHYELPFATEIDSKVRNKINNCDYDLCCVVSYDALIPNEILSKIPYSLNIHPSLLPKYKGSSPLQYTLLNQDDECGVTLQNLDPFRFDAGRIVTQTMPLKVEDVLAKNLTKLRYMFEGKVKTCAMQRQNADLSFLSIPAENRLYGDVFNVFKNEMGNIGSSLFHEYLNQEMFHTNVYVESKYKKSWARKLQKNVAQINWEKFTRSTILNNFGILKKLYTFKKQYLNKSKKQNFVHSDKTSSFQLKRVILSSLKEFNNPSKIPEALRQAPPGSFAPYDDEILGPRLLIKCLNDEYLVCEELQFESFQVEPAKKWIRNLNKRCNNKETLRNSSEMRFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.27
4 0.32
5 0.41
6 0.47
7 0.53
8 0.59
9 0.61
10 0.63
11 0.59
12 0.55
13 0.53
14 0.51
15 0.47
16 0.45
17 0.41
18 0.38
19 0.36
20 0.34
21 0.31
22 0.27
23 0.27
24 0.29
25 0.38
26 0.42
27 0.47
28 0.5
29 0.5
30 0.56
31 0.56
32 0.54
33 0.46
34 0.39
35 0.38
36 0.34
37 0.32
38 0.27
39 0.28
40 0.27
41 0.29
42 0.28
43 0.22
44 0.25
45 0.23
46 0.24
47 0.22
48 0.19
49 0.17
50 0.18
51 0.18
52 0.2
53 0.25
54 0.24
55 0.28
56 0.34
57 0.37
58 0.39
59 0.48
60 0.52
61 0.52
62 0.56
63 0.56
64 0.51
65 0.51
66 0.48
67 0.4
68 0.31
69 0.25
70 0.2
71 0.14
72 0.13
73 0.1
74 0.13
75 0.12
76 0.13
77 0.12
78 0.12
79 0.14
80 0.13
81 0.12
82 0.09
83 0.1
84 0.11
85 0.11
86 0.14
87 0.18
88 0.22
89 0.27
90 0.28
91 0.28
92 0.28
93 0.31
94 0.34
95 0.33
96 0.3
97 0.26
98 0.28
99 0.3
100 0.35
101 0.36
102 0.37
103 0.36
104 0.39
105 0.41
106 0.38
107 0.36
108 0.35
109 0.34
110 0.27
111 0.23
112 0.19
113 0.16
114 0.16
115 0.15
116 0.1
117 0.07
118 0.07
119 0.08
120 0.08
121 0.12
122 0.12
123 0.12
124 0.12
125 0.13
126 0.14
127 0.14
128 0.13
129 0.13
130 0.14
131 0.16
132 0.17
133 0.18
134 0.16
135 0.19
136 0.21
137 0.18
138 0.17
139 0.14
140 0.14
141 0.12
142 0.14
143 0.13
144 0.13
145 0.14
146 0.15
147 0.15
148 0.15
149 0.18
150 0.17
151 0.17
152 0.16
153 0.15
154 0.19
155 0.23
156 0.24
157 0.27
158 0.33
159 0.31
160 0.35
161 0.33
162 0.29
163 0.29
164 0.33
165 0.3
166 0.3
167 0.31
168 0.31
169 0.34
170 0.32
171 0.31
172 0.24
173 0.23
174 0.17
175 0.16
176 0.11
177 0.1
178 0.1
179 0.09
180 0.1
181 0.08
182 0.08
183 0.09
184 0.09
185 0.08
186 0.08
187 0.09
188 0.09
189 0.09
190 0.1
191 0.09
192 0.09
193 0.09
194 0.08
195 0.07
196 0.07
197 0.07
198 0.06
199 0.07
200 0.07
201 0.07
202 0.09
203 0.09
204 0.08
205 0.09
206 0.09
207 0.1
208 0.11
209 0.11
210 0.09
211 0.09
212 0.09
213 0.09
214 0.09
215 0.07
216 0.07
217 0.09
218 0.09
219 0.11
220 0.14
221 0.16
222 0.17
223 0.23
224 0.28
225 0.35
226 0.44
227 0.53
228 0.6
229 0.67
230 0.76
231 0.8
232 0.79
233 0.79
234 0.73
235 0.65
236 0.61
237 0.56
238 0.5
239 0.44
240 0.38
241 0.31
242 0.27
243 0.27
244 0.23
245 0.21
246 0.23
247 0.23
248 0.29
249 0.28
250 0.28
251 0.29
252 0.26
253 0.27
254 0.21
255 0.18
256 0.14
257 0.2
258 0.23
259 0.29
260 0.33
261 0.37
262 0.46
263 0.52
264 0.61
265 0.66
266 0.72
267 0.72
268 0.78
269 0.8
270 0.8
271 0.79
272 0.78
273 0.74
274 0.72
275 0.74
276 0.66
277 0.63
278 0.55
279 0.52
280 0.46
281 0.45
282 0.39
283 0.35
284 0.38
285 0.36
286 0.36
287 0.35
288 0.34
289 0.3
290 0.31
291 0.31
292 0.32
293 0.31
294 0.32
295 0.33
296 0.34
297 0.4
298 0.38
299 0.36
300 0.32
301 0.33
302 0.33
303 0.37
304 0.39
305 0.38
306 0.41
307 0.42
308 0.4
309 0.38
310 0.39
311 0.34
312 0.3
313 0.23
314 0.2
315 0.22
316 0.22
317 0.23
318 0.2
319 0.19
320 0.16
321 0.18
322 0.17
323 0.12
324 0.14
325 0.14
326 0.14
327 0.17
328 0.17
329 0.2
330 0.22
331 0.24
332 0.22
333 0.21
334 0.24
335 0.25
336 0.25
337 0.19
338 0.17
339 0.15
340 0.16
341 0.17
342 0.13
343 0.09
344 0.1
345 0.11
346 0.14
347 0.18
348 0.18
349 0.18
350 0.27
351 0.36
352 0.36
353 0.42
354 0.49
355 0.55
356 0.65
357 0.74
358 0.77
359 0.78
360 0.86
361 0.89
362 0.87
363 0.84
364 0.82
365 0.82
366 0.79
367 0.79
368 0.73
369 0.69
370 0.64