Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RB60

Protein Details
Accession A0A1E5RB60   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-30ILESKRARKLRQSLNKNGKTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021151  GINS_A  
IPR036224  GINS_bundle-like_dom_sf  
IPR005339  GINS_Psf1  
Gene Ontology GO:0000811  C:GINS complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05916  Sld5  
CDD cd11710  GINS_A_psf1  
cd21696  GINS_B_Psf1  
Amino Acid Sequences MYGDLATKLILESKRARKLRQSLNKNGKTIEAVVPEYQEEMVNKILKETEQLNSNAVFLQDSTQQNNKIKTCQYFVTLLSMERNKRCLLGYHKDRSDLIGEILWDKTNSTGTGFDINXLNHEEQQYMKEYSQLMSSLNGDFAEVDLTGSLKPPSEVFIDVRVLKDAGEIQTEYGVFHLIKDSQFFVRQSDVERLIQQGYLQKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.56
4 0.6
5 0.69
6 0.74
7 0.76
8 0.76
9 0.77
10 0.83
11 0.85
12 0.78
13 0.69
14 0.6
15 0.52
16 0.46
17 0.39
18 0.31
19 0.27
20 0.25
21 0.25
22 0.23
23 0.21
24 0.18
25 0.15
26 0.12
27 0.12
28 0.15
29 0.17
30 0.17
31 0.17
32 0.17
33 0.16
34 0.18
35 0.18
36 0.17
37 0.18
38 0.19
39 0.2
40 0.19
41 0.2
42 0.17
43 0.15
44 0.12
45 0.08
46 0.09
47 0.14
48 0.15
49 0.19
50 0.22
51 0.28
52 0.32
53 0.37
54 0.37
55 0.35
56 0.37
57 0.36
58 0.36
59 0.31
60 0.3
61 0.26
62 0.25
63 0.24
64 0.21
65 0.18
66 0.19
67 0.22
68 0.23
69 0.23
70 0.24
71 0.21
72 0.21
73 0.22
74 0.23
75 0.26
76 0.32
77 0.39
78 0.43
79 0.44
80 0.44
81 0.44
82 0.4
83 0.34
84 0.25
85 0.17
86 0.11
87 0.1
88 0.1
89 0.1
90 0.09
91 0.07
92 0.06
93 0.06
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.1
100 0.11
101 0.11
102 0.11
103 0.13
104 0.13
105 0.13
106 0.13
107 0.1
108 0.1
109 0.09
110 0.11
111 0.13
112 0.13
113 0.12
114 0.14
115 0.14
116 0.15
117 0.16
118 0.14
119 0.11
120 0.11
121 0.12
122 0.1
123 0.1
124 0.09
125 0.08
126 0.07
127 0.07
128 0.06
129 0.05
130 0.05
131 0.04
132 0.05
133 0.05
134 0.06
135 0.07
136 0.06
137 0.07
138 0.07
139 0.09
140 0.11
141 0.13
142 0.13
143 0.16
144 0.2
145 0.2
146 0.21
147 0.2
148 0.18
149 0.16
150 0.16
151 0.15
152 0.12
153 0.14
154 0.13
155 0.12
156 0.14
157 0.14
158 0.13
159 0.11
160 0.12
161 0.09
162 0.09
163 0.11
164 0.12
165 0.13
166 0.15
167 0.17
168 0.18
169 0.23
170 0.24
171 0.24
172 0.25
173 0.26
174 0.28
175 0.33
176 0.33
177 0.31
178 0.32
179 0.31
180 0.29
181 0.28
182 0.26