Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RH01

Protein Details
Accession A0A1E5RH01    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-52RIKYPTYKFKFLPKKRPMKSDTNLRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021036  Ribosomal_S35_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MFSSSMSNCSSSSCSYQLQQVRNISKRIKYPTYKFKFLPKKRPMKSDTNLRYAMRQFLGPKNYKGEYIFNKYYQAPTNNVPKYIVPQYEKGMALRDPKTGQVLSTTKIDSRRLIPSAIQRGARTLTSEKELHYIVERATPDFYKNTDSNPLHAPFPLNPFCKTNSLIDGSLKNYIYESIVTNKADPSVVSQKLKIKVPRLEAIIKLMSIEKDWEKSNSISANLENYXSSLSKMFPLYNARNDGENLQEIPIPENTKYSRFMVLAESQPFGPLDAANVLGLAPAESTLKKLADMSQGKNTKNKQNSKGKIVIGTKYKGEKSMFKFIDSKVGHVGYRYGAGNRDSKKDRKIGFNEVGQMIYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.36
4 0.4
5 0.42
6 0.46
7 0.5
8 0.56
9 0.59
10 0.64
11 0.62
12 0.61
13 0.64
14 0.66
15 0.67
16 0.67
17 0.7
18 0.74
19 0.76
20 0.77
21 0.72
22 0.74
23 0.76
24 0.76
25 0.78
26 0.78
27 0.8
28 0.8
29 0.87
30 0.83
31 0.82
32 0.8
33 0.8
34 0.77
35 0.74
36 0.72
37 0.63
38 0.62
39 0.54
40 0.52
41 0.42
42 0.38
43 0.35
44 0.38
45 0.46
46 0.44
47 0.45
48 0.46
49 0.45
50 0.44
51 0.42
52 0.42
53 0.4
54 0.44
55 0.45
56 0.41
57 0.43
58 0.42
59 0.43
60 0.42
61 0.38
62 0.33
63 0.34
64 0.43
65 0.42
66 0.41
67 0.39
68 0.33
69 0.35
70 0.37
71 0.38
72 0.31
73 0.32
74 0.33
75 0.36
76 0.36
77 0.32
78 0.29
79 0.26
80 0.29
81 0.28
82 0.29
83 0.25
84 0.26
85 0.29
86 0.26
87 0.23
88 0.23
89 0.23
90 0.22
91 0.23
92 0.23
93 0.22
94 0.26
95 0.29
96 0.24
97 0.26
98 0.29
99 0.28
100 0.28
101 0.29
102 0.32
103 0.38
104 0.39
105 0.37
106 0.32
107 0.33
108 0.33
109 0.3
110 0.25
111 0.2
112 0.18
113 0.2
114 0.21
115 0.19
116 0.2
117 0.2
118 0.17
119 0.17
120 0.16
121 0.12
122 0.16
123 0.16
124 0.14
125 0.16
126 0.16
127 0.15
128 0.16
129 0.16
130 0.17
131 0.17
132 0.18
133 0.26
134 0.25
135 0.26
136 0.3
137 0.3
138 0.26
139 0.25
140 0.25
141 0.18
142 0.23
143 0.27
144 0.24
145 0.24
146 0.26
147 0.27
148 0.28
149 0.28
150 0.24
151 0.2
152 0.21
153 0.2
154 0.2
155 0.19
156 0.18
157 0.19
158 0.18
159 0.15
160 0.12
161 0.12
162 0.11
163 0.1
164 0.1
165 0.1
166 0.12
167 0.13
168 0.13
169 0.13
170 0.12
171 0.12
172 0.11
173 0.12
174 0.17
175 0.2
176 0.2
177 0.23
178 0.28
179 0.32
180 0.37
181 0.36
182 0.36
183 0.38
184 0.41
185 0.41
186 0.4
187 0.38
188 0.34
189 0.33
190 0.26
191 0.21
192 0.18
193 0.15
194 0.12
195 0.1
196 0.12
197 0.1
198 0.11
199 0.13
200 0.14
201 0.15
202 0.16
203 0.18
204 0.17
205 0.17
206 0.16
207 0.16
208 0.17
209 0.15
210 0.15
211 0.12
212 0.11
213 0.11
214 0.1
215 0.1
216 0.07
217 0.08
218 0.09
219 0.1
220 0.12
221 0.18
222 0.22
223 0.26
224 0.3
225 0.3
226 0.3
227 0.3
228 0.29
229 0.23
230 0.21
231 0.17
232 0.13
233 0.14
234 0.13
235 0.14
236 0.16
237 0.15
238 0.14
239 0.18
240 0.19
241 0.21
242 0.23
243 0.23
244 0.23
245 0.21
246 0.22
247 0.22
248 0.24
249 0.26
250 0.25
251 0.24
252 0.21
253 0.22
254 0.2
255 0.17
256 0.14
257 0.09
258 0.08
259 0.08
260 0.08
261 0.07
262 0.07
263 0.06
264 0.06
265 0.06
266 0.05
267 0.04
268 0.04
269 0.06
270 0.06
271 0.08
272 0.1
273 0.11
274 0.11
275 0.13
276 0.15
277 0.24
278 0.29
279 0.31
280 0.39
281 0.45
282 0.46
283 0.53
284 0.56
285 0.56
286 0.6
287 0.66
288 0.66
289 0.71
290 0.76
291 0.77
292 0.78
293 0.7
294 0.68
295 0.63
296 0.6
297 0.56
298 0.52
299 0.49
300 0.48
301 0.47
302 0.45
303 0.44
304 0.46
305 0.46
306 0.54
307 0.5
308 0.47
309 0.5
310 0.45
311 0.51
312 0.43
313 0.39
314 0.34
315 0.35
316 0.32
317 0.29
318 0.3
319 0.21
320 0.24
321 0.23
322 0.19
323 0.21
324 0.24
325 0.31
326 0.33
327 0.4
328 0.44
329 0.5
330 0.56
331 0.61
332 0.63
333 0.66
334 0.69
335 0.7
336 0.69
337 0.67
338 0.65
339 0.57