Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5R4U6

Protein Details
Accession A0A1E5R4U6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
207-230TSMSLEKKERKGKVLKKKKNMIKKBasic
NLS Segment(s)
PositionSequence
214-231KKERKGKVLKKKKNMIKK
Subcellular Location(s) nucl 15, mito_nucl 12.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MSLKSTQNIIATKKQVYKPILDNPYTDIATFPHVNSQHEIKSLLELSVLKTFKQFWQMQQNNQQQLSSRTCPVDIVFGFNKVMQYLESNIDEPCFVFVCNKDGLTKILHQHLPMLVANRNSQPNKQHMXRLIQLPKSSLDMFNANLPLRSSTLDHEDGDYHYGILIVKGENIPGSLRIHVHTNVPDVSIPYLETSYVPCSENLHLLSTSMSLEKKERKGKVLKKKKNMIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.53
4 0.54
5 0.53
6 0.58
7 0.6
8 0.53
9 0.5
10 0.46
11 0.47
12 0.41
13 0.34
14 0.25
15 0.18
16 0.22
17 0.22
18 0.19
19 0.21
20 0.22
21 0.25
22 0.27
23 0.31
24 0.27
25 0.28
26 0.29
27 0.22
28 0.23
29 0.22
30 0.18
31 0.16
32 0.14
33 0.15
34 0.21
35 0.21
36 0.18
37 0.18
38 0.2
39 0.21
40 0.29
41 0.29
42 0.29
43 0.4
44 0.44
45 0.5
46 0.58
47 0.64
48 0.61
49 0.59
50 0.53
51 0.44
52 0.45
53 0.44
54 0.36
55 0.31
56 0.27
57 0.26
58 0.26
59 0.24
60 0.24
61 0.18
62 0.2
63 0.17
64 0.18
65 0.18
66 0.18
67 0.18
68 0.12
69 0.13
70 0.08
71 0.09
72 0.09
73 0.11
74 0.12
75 0.12
76 0.12
77 0.12
78 0.12
79 0.1
80 0.09
81 0.07
82 0.06
83 0.07
84 0.08
85 0.1
86 0.11
87 0.11
88 0.11
89 0.11
90 0.13
91 0.13
92 0.15
93 0.15
94 0.19
95 0.2
96 0.19
97 0.19
98 0.18
99 0.18
100 0.16
101 0.16
102 0.13
103 0.14
104 0.15
105 0.17
106 0.22
107 0.21
108 0.23
109 0.25
110 0.32
111 0.37
112 0.37
113 0.39
114 0.35
115 0.41
116 0.46
117 0.48
118 0.44
119 0.4
120 0.39
121 0.35
122 0.36
123 0.3
124 0.23
125 0.18
126 0.15
127 0.14
128 0.15
129 0.17
130 0.14
131 0.14
132 0.14
133 0.13
134 0.13
135 0.14
136 0.13
137 0.12
138 0.17
139 0.18
140 0.18
141 0.18
142 0.18
143 0.17
144 0.18
145 0.16
146 0.11
147 0.09
148 0.09
149 0.08
150 0.07
151 0.08
152 0.06
153 0.07
154 0.07
155 0.08
156 0.07
157 0.08
158 0.08
159 0.09
160 0.11
161 0.11
162 0.12
163 0.13
164 0.17
165 0.18
166 0.21
167 0.2
168 0.22
169 0.21
170 0.2
171 0.2
172 0.17
173 0.17
174 0.14
175 0.13
176 0.11
177 0.11
178 0.1
179 0.1
180 0.11
181 0.13
182 0.15
183 0.15
184 0.14
185 0.17
186 0.19
187 0.23
188 0.22
189 0.21
190 0.19
191 0.19
192 0.19
193 0.17
194 0.16
195 0.15
196 0.14
197 0.14
198 0.21
199 0.29
200 0.38
201 0.46
202 0.5
203 0.55
204 0.65
205 0.73
206 0.77
207 0.81
208 0.82
209 0.84
210 0.9