Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RAN3

Protein Details
Accession A0A1E5RAN3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-120AEAVEKASRQQRKQRKNRGKKVFGTGKRLAHydrophilic
NLS Segment(s)
PositionSequence
98-127SRQQRKQRKNRGKKVFGTGKRLAKKVARRN
Subcellular Location(s) cyto 15.5, cyto_nucl 11.5, mito 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVCTTSHLLEYTFRKQFVVDVLHPNRANVSKDEMRERLAEIYKAEKDAVSVFGFRTQFGGGKSTGFGLIYNSVADAKKFEPTYRLVRYGMAEAVEKASRQQRKQRKNRGKKVFGTGKRLAKKVARRNAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.32
4 0.31
5 0.32
6 0.28
7 0.34
8 0.36
9 0.44
10 0.44
11 0.42
12 0.4
13 0.37
14 0.35
15 0.27
16 0.32
17 0.29
18 0.32
19 0.38
20 0.36
21 0.34
22 0.33
23 0.32
24 0.29
25 0.27
26 0.25
27 0.2
28 0.23
29 0.22
30 0.22
31 0.21
32 0.15
33 0.14
34 0.14
35 0.15
36 0.11
37 0.11
38 0.1
39 0.14
40 0.14
41 0.13
42 0.14
43 0.12
44 0.12
45 0.12
46 0.14
47 0.1
48 0.1
49 0.1
50 0.09
51 0.09
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.12
65 0.13
66 0.13
67 0.15
68 0.19
69 0.26
70 0.28
71 0.3
72 0.27
73 0.28
74 0.29
75 0.27
76 0.24
77 0.18
78 0.14
79 0.12
80 0.14
81 0.13
82 0.12
83 0.14
84 0.21
85 0.27
86 0.33
87 0.43
88 0.51
89 0.62
90 0.73
91 0.81
92 0.85
93 0.89
94 0.93
95 0.94
96 0.93
97 0.88
98 0.88
99 0.87
100 0.83
101 0.8
102 0.78
103 0.76
104 0.74
105 0.69
106 0.65
107 0.63
108 0.66
109 0.68