Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5R888

Protein Details
Accession A0A1E5R888   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-37DITNGSKPKSSKKNNIKRRRNKKRRTADVTSSEDSHydrophilic
NLS Segment(s)
PositionSequence
9-27KPKSSKKNNIKRRRNKKRR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MSDITNGSKPKSSKKNNIKRRRNKKRRTADVTSSEDSDASSDVSLGTDSDKEDNTTTGQQSVSLQEEDADIKLSDTEADQDKNMDNAADVEMADAQYEGRKRLNEIKLTNSLKEINGPAHSNTQTLGDYNKASQNLDNLDKDLKTKFLQMTFEHYGEDVNQLRDASDFTNKSLVILANALKEGARMFDNDSLKSILE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.79
3 0.84
4 0.92
5 0.93
6 0.94
7 0.95
8 0.96
9 0.96
10 0.96
11 0.96
12 0.95
13 0.95
14 0.93
15 0.9
16 0.88
17 0.85
18 0.81
19 0.73
20 0.63
21 0.52
22 0.43
23 0.34
24 0.25
25 0.17
26 0.11
27 0.08
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.08
36 0.09
37 0.1
38 0.11
39 0.12
40 0.13
41 0.14
42 0.17
43 0.16
44 0.16
45 0.15
46 0.15
47 0.15
48 0.16
49 0.16
50 0.13
51 0.12
52 0.11
53 0.11
54 0.11
55 0.1
56 0.1
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.11
71 0.08
72 0.06
73 0.06
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.03
83 0.06
84 0.06
85 0.08
86 0.09
87 0.1
88 0.12
89 0.21
90 0.26
91 0.3
92 0.31
93 0.34
94 0.41
95 0.43
96 0.41
97 0.34
98 0.3
99 0.24
100 0.24
101 0.21
102 0.14
103 0.14
104 0.15
105 0.15
106 0.18
107 0.19
108 0.17
109 0.16
110 0.16
111 0.14
112 0.13
113 0.13
114 0.11
115 0.11
116 0.12
117 0.15
118 0.14
119 0.15
120 0.15
121 0.17
122 0.19
123 0.22
124 0.21
125 0.2
126 0.21
127 0.2
128 0.21
129 0.19
130 0.19
131 0.16
132 0.2
133 0.22
134 0.23
135 0.27
136 0.26
137 0.33
138 0.34
139 0.34
140 0.29
141 0.26
142 0.23
143 0.2
144 0.24
145 0.18
146 0.15
147 0.16
148 0.16
149 0.16
150 0.16
151 0.17
152 0.14
153 0.19
154 0.19
155 0.19
156 0.23
157 0.23
158 0.23
159 0.24
160 0.22
161 0.15
162 0.17
163 0.17
164 0.15
165 0.15
166 0.15
167 0.12
168 0.12
169 0.11
170 0.11
171 0.1
172 0.1
173 0.14
174 0.21
175 0.24
176 0.24
177 0.26