Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2AYK9

Protein Details
Accession H2AYK9    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-30LQITKNPSPSRPRPNDQLQFGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 6, nucl 5, extr 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001544  Aminotrans_IV  
IPR018300  Aminotrans_IV_CS  
IPR036038  Aminotransferase-like  
IPR005786  B_amino_transII  
IPR043132  BCAT-like_C  
IPR043131  BCAT-like_N  
IPR033939  BCAT_family  
Gene Ontology GO:0052656  F:L-isoleucine transaminase activity  
GO:0052654  F:L-leucine transaminase activity  
GO:0050048  F:L-leucine:2-oxoglutarate aminotransferase activity  
GO:0052655  F:L-valine transaminase activity  
GO:0008652  P:amino acid biosynthetic process  
GO:0009082  P:branched-chain amino acid biosynthetic process  
KEGG kaf:KAFR_0H03760  -  
Pfam View protein in Pfam  
PF01063  Aminotran_4  
PROSITE View protein in PROSITE  
PS00770  AA_TRANSFER_CLASS_4  
CDD cd01557  BCAT_beta_family  
Amino Acid Sequences MKTPLNSSNLQITKNPSPSRPRPNDQLQFGKTFTDHMLIVEWNANEGWGNPQIKPYGPFSLDPSSVVFHYGFELFEGMKAYRTVDNKITLFRPDKNMKRMNESAARICLPEFDGNELIKLIGKLIELDKHLIPQGEGYSLYIRPTMIGTSETLSVVSPDKALLYVICSPVGPYYKTGFKAVKLEATDYATRAWPGGCGDKKLGANYAPCVLPQLVAAQRGYQQNLWLFGPEKNITEVGTMNAFFVFSNPNTGKNELVTAPLDGTILPGVTRDSILELARKRLDPHRWEINERYCTIFELSEKSKNGELVEAFGSGTAAIVSPIKEIGWKNEKIQVPLSPGEETGPFTKEAAQWILDIQYGKVTQGNWSETVADLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.51
4 0.58
5 0.65
6 0.73
7 0.74
8 0.73
9 0.73
10 0.8
11 0.81
12 0.79
13 0.79
14 0.72
15 0.67
16 0.6
17 0.54
18 0.43
19 0.37
20 0.3
21 0.23
22 0.19
23 0.16
24 0.17
25 0.15
26 0.16
27 0.17
28 0.16
29 0.14
30 0.14
31 0.13
32 0.11
33 0.12
34 0.14
35 0.17
36 0.19
37 0.18
38 0.22
39 0.24
40 0.26
41 0.28
42 0.28
43 0.28
44 0.28
45 0.29
46 0.31
47 0.35
48 0.33
49 0.31
50 0.28
51 0.24
52 0.21
53 0.22
54 0.17
55 0.12
56 0.13
57 0.13
58 0.11
59 0.1
60 0.11
61 0.09
62 0.09
63 0.11
64 0.1
65 0.11
66 0.11
67 0.13
68 0.17
69 0.19
70 0.22
71 0.24
72 0.3
73 0.29
74 0.32
75 0.32
76 0.34
77 0.36
78 0.35
79 0.4
80 0.44
81 0.51
82 0.57
83 0.62
84 0.58
85 0.62
86 0.62
87 0.59
88 0.57
89 0.53
90 0.47
91 0.43
92 0.41
93 0.33
94 0.3
95 0.25
96 0.2
97 0.19
98 0.16
99 0.16
100 0.18
101 0.17
102 0.18
103 0.17
104 0.14
105 0.12
106 0.12
107 0.09
108 0.07
109 0.07
110 0.08
111 0.09
112 0.12
113 0.12
114 0.15
115 0.14
116 0.15
117 0.16
118 0.15
119 0.13
120 0.12
121 0.12
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.11
128 0.1
129 0.09
130 0.09
131 0.09
132 0.08
133 0.07
134 0.07
135 0.07
136 0.08
137 0.09
138 0.09
139 0.08
140 0.08
141 0.08
142 0.09
143 0.08
144 0.07
145 0.06
146 0.06
147 0.06
148 0.06
149 0.05
150 0.07
151 0.09
152 0.09
153 0.09
154 0.09
155 0.09
156 0.11
157 0.13
158 0.11
159 0.11
160 0.13
161 0.16
162 0.18
163 0.21
164 0.2
165 0.2
166 0.24
167 0.22
168 0.23
169 0.2
170 0.2
171 0.18
172 0.2
173 0.18
174 0.15
175 0.15
176 0.12
177 0.11
178 0.1
179 0.09
180 0.07
181 0.08
182 0.14
183 0.14
184 0.16
185 0.16
186 0.2
187 0.21
188 0.21
189 0.21
190 0.16
191 0.16
192 0.16
193 0.17
194 0.13
195 0.12
196 0.14
197 0.12
198 0.1
199 0.09
200 0.12
201 0.11
202 0.13
203 0.13
204 0.12
205 0.16
206 0.18
207 0.19
208 0.16
209 0.17
210 0.17
211 0.19
212 0.18
213 0.15
214 0.15
215 0.14
216 0.19
217 0.17
218 0.17
219 0.16
220 0.16
221 0.15
222 0.14
223 0.14
224 0.1
225 0.1
226 0.09
227 0.08
228 0.08
229 0.08
230 0.07
231 0.07
232 0.09
233 0.08
234 0.15
235 0.15
236 0.19
237 0.21
238 0.23
239 0.22
240 0.2
241 0.22
242 0.16
243 0.17
244 0.14
245 0.12
246 0.11
247 0.11
248 0.1
249 0.08
250 0.08
251 0.06
252 0.05
253 0.05
254 0.05
255 0.05
256 0.06
257 0.06
258 0.06
259 0.07
260 0.09
261 0.1
262 0.16
263 0.16
264 0.21
265 0.24
266 0.25
267 0.27
268 0.33
269 0.42
270 0.42
271 0.48
272 0.53
273 0.54
274 0.59
275 0.63
276 0.64
277 0.59
278 0.55
279 0.52
280 0.42
281 0.39
282 0.35
283 0.29
284 0.21
285 0.23
286 0.25
287 0.28
288 0.29
289 0.3
290 0.3
291 0.31
292 0.3
293 0.27
294 0.24
295 0.2
296 0.19
297 0.17
298 0.15
299 0.13
300 0.12
301 0.08
302 0.08
303 0.05
304 0.04
305 0.04
306 0.06
307 0.06
308 0.07
309 0.07
310 0.07
311 0.12
312 0.13
313 0.22
314 0.29
315 0.31
316 0.33
317 0.41
318 0.44
319 0.43
320 0.45
321 0.4
322 0.38
323 0.39
324 0.38
325 0.31
326 0.28
327 0.27
328 0.24
329 0.23
330 0.2
331 0.19
332 0.17
333 0.17
334 0.21
335 0.2
336 0.24
337 0.23
338 0.22
339 0.2
340 0.21
341 0.21
342 0.2
343 0.19
344 0.15
345 0.17
346 0.16
347 0.17
348 0.18
349 0.17
350 0.21
351 0.26
352 0.29
353 0.26
354 0.26
355 0.26