Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RA11

Protein Details
Accession A0A1E5RA11    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-22KIVKKHTKKFKRHH
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSCVRRRFRGNISEPTIGYGSNKKTKFLSPSGHKTFLVANVKDLELLTMHTKTYAAEIKSTVSSKNRVGILSKAKALGIKVTNPKGKLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.86
14 0.76
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.62
24 0.58
25 0.54
26 0.52
27 0.51
28 0.57
29 0.66
30 0.68
31 0.61
32 0.59
33 0.57
34 0.55
35 0.55
36 0.52
37 0.5
38 0.52
39 0.52
40 0.48
41 0.44
42 0.37
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.23
50 0.25
51 0.27
52 0.31
53 0.31
54 0.34
55 0.34
56 0.43
57 0.47
58 0.48
59 0.45
60 0.41
61 0.37
62 0.36
63 0.36
64 0.27
65 0.24
66 0.22
67 0.22
68 0.22
69 0.21
70 0.14
71 0.07
72 0.09
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.13
80 0.16
81 0.14
82 0.15
83 0.16
84 0.18
85 0.21
86 0.22
87 0.22
88 0.21
89 0.24
90 0.25
91 0.3
92 0.29
93 0.28
94 0.29
95 0.33
96 0.37
97 0.37
98 0.36
99 0.32
100 0.31
101 0.32
102 0.3
103 0.3
104 0.25
105 0.28
106 0.35
107 0.43
108 0.48
109 0.47
110 0.49
111 0.46