Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RV47

Protein Details
Accession A0A1E5RV47    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-99EAQSARPQRKTRRLMNSHSNVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR003780  COX15/CtaA_fam  
IPR023754  HemeA_Synthase_type2  
Gene Ontology GO:0016020  C:membrane  
GO:0016653  F:oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor  
GO:0006784  P:heme A biosynthetic process  
Pfam View protein in Pfam  
PF02628  COX15-CtaA  
Amino Acid Sequences MFRNIVSLKQGVRALSLFNSTASKNARISTSTATLFSKSFSPSLKSMTASVXTSISSKSTLQRRFFQTKNSKLYSTVQEEAQSARPQRKTRRLMNSHSNVGYWLIGTSGLVFGIVVLGGLTRLTESGLSITEWKPVTGTIPPLNQKEWEEEFAKYKDSPEFKQLNSHITLDEFKFIFFMEWFHRLWGRAIGGIFVVPTLYLLASRYTSARVNRRLLGLSALLGLQGVIGWWMVKSGLDEENLEERKSKPTVSQYRLTTHLGAAFMLYMGMLWTGWEIVRENKWMKNPXESIKIFEKLNNPQLKPLKKMSLALVALXFLTAMSGGLVAGLDAGLIYNTFPKMGDTWFPSKRELLDKNFSRKEDNSDLVVRNVLDNPTTVQLNHRILAITTFTAVLAFHMYAVKRKALIPKNVNRTIHAMMGLVTLQAALGIATLVYLVPISLASAHQAGALALLTSTLLCASQLRRPRPIMQQLIMNLQKNGIPQKTGSKILRQINGMPMKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.25
4 0.2
5 0.19
6 0.21
7 0.19
8 0.24
9 0.26
10 0.28
11 0.27
12 0.29
13 0.3
14 0.3
15 0.33
16 0.32
17 0.33
18 0.3
19 0.3
20 0.3
21 0.29
22 0.27
23 0.25
24 0.23
25 0.2
26 0.22
27 0.22
28 0.25
29 0.26
30 0.31
31 0.32
32 0.3
33 0.29
34 0.29
35 0.28
36 0.24
37 0.23
38 0.2
39 0.19
40 0.18
41 0.17
42 0.15
43 0.15
44 0.22
45 0.3
46 0.36
47 0.4
48 0.48
49 0.56
50 0.62
51 0.63
52 0.67
53 0.68
54 0.69
55 0.73
56 0.69
57 0.62
58 0.57
59 0.6
60 0.57
61 0.53
62 0.46
63 0.38
64 0.36
65 0.35
66 0.35
67 0.34
68 0.32
69 0.3
70 0.36
71 0.42
72 0.48
73 0.58
74 0.65
75 0.69
76 0.73
77 0.79
78 0.79
79 0.81
80 0.83
81 0.79
82 0.76
83 0.67
84 0.58
85 0.47
86 0.4
87 0.32
88 0.21
89 0.14
90 0.08
91 0.07
92 0.06
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.02
103 0.02
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.05
112 0.05
113 0.06
114 0.07
115 0.11
116 0.11
117 0.15
118 0.16
119 0.15
120 0.15
121 0.14
122 0.16
123 0.14
124 0.19
125 0.18
126 0.24
127 0.29
128 0.31
129 0.32
130 0.32
131 0.31
132 0.32
133 0.31
134 0.29
135 0.26
136 0.26
137 0.29
138 0.28
139 0.29
140 0.23
141 0.23
142 0.25
143 0.27
144 0.28
145 0.32
146 0.35
147 0.33
148 0.41
149 0.41
150 0.39
151 0.37
152 0.36
153 0.27
154 0.24
155 0.27
156 0.19
157 0.21
158 0.16
159 0.13
160 0.12
161 0.12
162 0.12
163 0.09
164 0.11
165 0.11
166 0.13
167 0.14
168 0.15
169 0.16
170 0.16
171 0.17
172 0.17
173 0.15
174 0.14
175 0.14
176 0.13
177 0.11
178 0.1
179 0.09
180 0.06
181 0.05
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.05
189 0.06
190 0.07
191 0.07
192 0.09
193 0.13
194 0.19
195 0.26
196 0.31
197 0.34
198 0.35
199 0.36
200 0.35
201 0.32
202 0.28
203 0.2
204 0.14
205 0.11
206 0.09
207 0.07
208 0.06
209 0.05
210 0.03
211 0.03
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.03
218 0.03
219 0.03
220 0.04
221 0.06
222 0.07
223 0.08
224 0.08
225 0.09
226 0.15
227 0.16
228 0.16
229 0.15
230 0.15
231 0.18
232 0.19
233 0.18
234 0.16
235 0.25
236 0.34
237 0.37
238 0.43
239 0.41
240 0.43
241 0.46
242 0.44
243 0.35
244 0.26
245 0.23
246 0.17
247 0.14
248 0.11
249 0.08
250 0.06
251 0.05
252 0.04
253 0.02
254 0.02
255 0.02
256 0.02
257 0.02
258 0.02
259 0.03
260 0.03
261 0.04
262 0.05
263 0.07
264 0.09
265 0.13
266 0.16
267 0.19
268 0.24
269 0.28
270 0.3
271 0.36
272 0.37
273 0.37
274 0.39
275 0.39
276 0.36
277 0.34
278 0.33
279 0.29
280 0.32
281 0.32
282 0.37
283 0.41
284 0.39
285 0.43
286 0.49
287 0.48
288 0.48
289 0.47
290 0.44
291 0.39
292 0.41
293 0.35
294 0.35
295 0.32
296 0.27
297 0.23
298 0.18
299 0.16
300 0.14
301 0.11
302 0.04
303 0.04
304 0.03
305 0.02
306 0.02
307 0.02
308 0.02
309 0.02
310 0.02
311 0.02
312 0.02
313 0.02
314 0.02
315 0.02
316 0.02
317 0.02
318 0.03
319 0.04
320 0.05
321 0.05
322 0.05
323 0.06
324 0.08
325 0.09
326 0.13
327 0.16
328 0.24
329 0.28
330 0.3
331 0.31
332 0.32
333 0.33
334 0.38
335 0.39
336 0.38
337 0.44
338 0.49
339 0.56
340 0.59
341 0.58
342 0.55
343 0.51
344 0.52
345 0.48
346 0.44
347 0.38
348 0.38
349 0.38
350 0.33
351 0.33
352 0.25
353 0.21
354 0.2
355 0.17
356 0.12
357 0.11
358 0.12
359 0.13
360 0.14
361 0.12
362 0.14
363 0.21
364 0.23
365 0.23
366 0.22
367 0.2
368 0.2
369 0.21
370 0.19
371 0.12
372 0.1
373 0.1
374 0.09
375 0.09
376 0.08
377 0.07
378 0.07
379 0.07
380 0.07
381 0.1
382 0.11
383 0.15
384 0.18
385 0.19
386 0.19
387 0.23
388 0.32
389 0.37
390 0.47
391 0.52
392 0.59
393 0.67
394 0.73
395 0.71
396 0.63
397 0.61
398 0.53
399 0.45
400 0.36
401 0.27
402 0.19
403 0.19
404 0.17
405 0.11
406 0.08
407 0.06
408 0.05
409 0.05
410 0.04
411 0.03
412 0.03
413 0.03
414 0.03
415 0.03
416 0.03
417 0.03
418 0.03
419 0.03
420 0.03
421 0.03
422 0.03
423 0.04
424 0.04
425 0.05
426 0.07
427 0.08
428 0.08
429 0.08
430 0.09
431 0.08
432 0.08
433 0.08
434 0.06
435 0.05
436 0.05
437 0.05
438 0.04
439 0.05
440 0.04
441 0.04
442 0.05
443 0.08
444 0.11
445 0.19
446 0.28
447 0.34
448 0.41
449 0.46
450 0.52
451 0.59
452 0.66
453 0.67
454 0.61
455 0.61
456 0.57
457 0.61
458 0.6
459 0.52
460 0.43
461 0.36
462 0.35
463 0.33
464 0.38
465 0.32
466 0.28
467 0.29
468 0.37
469 0.41
470 0.48
471 0.48
472 0.48
473 0.54
474 0.6
475 0.63
476 0.57
477 0.56
478 0.57