Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RE12

Protein Details
Accession A0A1E5RE12    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAAPRETKRKAGTRKKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
6-24ETKRKAGTRKKKDPNAPKR
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAPRETKRKAGTRKKKDPNAPKRALSAYMFFANENRDIVRAENPGISFGQVGKMLGEKWKQLSEDEKAPYDAKAGADKKRYESEKQLYLATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.9
3 0.91
4 0.92
5 0.92
6 0.92
7 0.92
8 0.87
9 0.78
10 0.72
11 0.65
12 0.58
13 0.48
14 0.4
15 0.32
16 0.28
17 0.25
18 0.21
19 0.19
20 0.18
21 0.16
22 0.15
23 0.12
24 0.1
25 0.11
26 0.12
27 0.13
28 0.12
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.12
35 0.09
36 0.08
37 0.09
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.11
44 0.13
45 0.13
46 0.15
47 0.17
48 0.18
49 0.19
50 0.23
51 0.23
52 0.28
53 0.29
54 0.28
55 0.28
56 0.28
57 0.26
58 0.23
59 0.21
60 0.16
61 0.22
62 0.25
63 0.29
64 0.36
65 0.38
66 0.41
67 0.48
68 0.51
69 0.49
70 0.55
71 0.56
72 0.56
73 0.56
74 0.56