Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RAB1

Protein Details
Accession A0A1E5RAB1   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKKRASNGRNKKGRGHVKPVRCNNCSHydrophilic
81-106ARIVRVRSRVDRRNRAPPQRTRFARAHydrophilic
NLS Segment(s)
PositionSequence
3-19KKRASNGRNKKGRGHVK
89-109RVDRRNRAPPQRTRFARAGAK
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCNNCSKSVPKDKAIKRVSIRNIVETAAIRDLSEASVYAEYALPKIYNKAHYCVSCAIHARIVRVRSRVDRRNRAPPQRTRFARAGAKVTPGDAAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.77
6 0.84
7 0.86
8 0.84
9 0.76
10 0.75
11 0.7
12 0.7
13 0.65
14 0.59
15 0.59
16 0.6
17 0.62
18 0.62
19 0.67
20 0.62
21 0.67
22 0.66
23 0.64
24 0.58
25 0.61
26 0.6
27 0.59
28 0.55
29 0.47
30 0.45
31 0.37
32 0.34
33 0.26
34 0.22
35 0.14
36 0.13
37 0.1
38 0.09
39 0.09
40 0.08
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.09
54 0.1
55 0.17
56 0.18
57 0.21
58 0.25
59 0.25
60 0.28
61 0.29
62 0.28
63 0.24
64 0.25
65 0.23
66 0.23
67 0.23
68 0.24
69 0.25
70 0.27
71 0.28
72 0.28
73 0.32
74 0.37
75 0.46
76 0.52
77 0.58
78 0.65
79 0.67
80 0.75
81 0.81
82 0.82
83 0.83
84 0.84
85 0.82
86 0.82
87 0.81
88 0.76
89 0.7
90 0.67
91 0.66
92 0.6
93 0.57
94 0.49
95 0.49
96 0.43
97 0.39
98 0.35
99 0.29
100 0.28