Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RH45

Protein Details
Accession A0A1E5RH45   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-38ANLLVRNKWTKPKPKPAPRTNVRPPTIHydrophilic
NLS Segment(s)
PositionSequence
22-27KPKPKP
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR038340  MRP-L47_sf  
IPR010729  Ribosomal_L47_mit  
Gene Ontology GO:0005761  C:mitochondrial ribosome  
GO:1990904  C:ribonucleoprotein complex  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF06984  MRP-L47  
Amino Acid Sequences MLKFRRELHTSANLLVRNKWTKPKPKPAPRTNVRPPTITSHHSGSLRITPPIPPSVKNLETSEYHPLWQFFSNKKYIRGQIELDEYSRPWTVAELRLKSFDDLHSLWYSCLKEMNVLRREIELFDNQKIGGNVEAYENVQKKVQTTLWRIRHTLSERQWSYEYANQMFNDDQKIKEFLETFESEENQDVIKRLNNSIKQAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.43
4 0.4
5 0.42
6 0.49
7 0.53
8 0.6
9 0.68
10 0.76
11 0.79
12 0.84
13 0.91
14 0.91
15 0.92
16 0.9
17 0.9
18 0.89
19 0.88
20 0.8
21 0.72
22 0.64
23 0.62
24 0.59
25 0.51
26 0.45
27 0.38
28 0.4
29 0.38
30 0.36
31 0.3
32 0.32
33 0.31
34 0.28
35 0.25
36 0.23
37 0.25
38 0.31
39 0.3
40 0.24
41 0.27
42 0.33
43 0.34
44 0.35
45 0.33
46 0.3
47 0.3
48 0.31
49 0.33
50 0.26
51 0.25
52 0.24
53 0.22
54 0.22
55 0.23
56 0.25
57 0.22
58 0.26
59 0.32
60 0.33
61 0.37
62 0.39
63 0.41
64 0.41
65 0.4
66 0.38
67 0.33
68 0.35
69 0.32
70 0.28
71 0.23
72 0.19
73 0.18
74 0.16
75 0.13
76 0.09
77 0.09
78 0.1
79 0.16
80 0.22
81 0.22
82 0.22
83 0.24
84 0.25
85 0.24
86 0.23
87 0.17
88 0.15
89 0.13
90 0.15
91 0.14
92 0.14
93 0.14
94 0.16
95 0.16
96 0.12
97 0.14
98 0.11
99 0.14
100 0.17
101 0.26
102 0.26
103 0.27
104 0.27
105 0.26
106 0.27
107 0.24
108 0.23
109 0.2
110 0.19
111 0.19
112 0.19
113 0.18
114 0.19
115 0.18
116 0.16
117 0.12
118 0.1
119 0.09
120 0.09
121 0.1
122 0.09
123 0.14
124 0.15
125 0.15
126 0.16
127 0.16
128 0.16
129 0.2
130 0.24
131 0.26
132 0.32
133 0.41
134 0.48
135 0.51
136 0.51
137 0.49
138 0.53
139 0.5
140 0.52
141 0.48
142 0.5
143 0.48
144 0.51
145 0.51
146 0.44
147 0.44
148 0.39
149 0.38
150 0.3
151 0.33
152 0.28
153 0.3
154 0.29
155 0.26
156 0.29
157 0.25
158 0.24
159 0.23
160 0.26
161 0.23
162 0.26
163 0.26
164 0.2
165 0.25
166 0.25
167 0.25
168 0.26
169 0.26
170 0.23
171 0.23
172 0.23
173 0.17
174 0.18
175 0.16
176 0.15
177 0.2
178 0.21
179 0.26
180 0.35
181 0.39