Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5S120

Protein Details
Accession A0A1E5S120    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AKLVHNAQKKQHRERSQTQSRTKFGFHydrophilic
187-211QKESLDKKKLKKYKLLKQYIDREKEBasic
220-245ELQKEVMKKGSKKKIKTDEGKVIYKWHydrophilic
NLS Segment(s)
PositionSequence
227-251KKGSKKKIKTDEGKVIYKWKKERKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MAKLVHNAQKKQHRERSQTQSRTKFGFLEKHKDYTKRAKDYHAKQNTLKILRGKANERNPDEYYHKMNSQKMDSKTGLLIKEREESESLSVDQVKLLKTQDSNYLRLLQQQNLKQILKKKEGLLFDLENDNKHKIFVDENEDLKNFDLAKRLNTHKDLLNRKENRLTIEQLANVNNNGIGQVEDIMQKESLDKKKLKKYKLLKQYIDREKEIRTVLDTLELQKEVMKKGSKKKIKTDEGKVIYKWKKERKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.88
5 0.88
6 0.87
7 0.85
8 0.8
9 0.75
10 0.67
11 0.61
12 0.56
13 0.56
14 0.52
15 0.53
16 0.52
17 0.55
18 0.58
19 0.59
20 0.6
21 0.62
22 0.65
23 0.65
24 0.64
25 0.67
26 0.71
27 0.75
28 0.78
29 0.77
30 0.72
31 0.66
32 0.71
33 0.69
34 0.63
35 0.59
36 0.54
37 0.5
38 0.51
39 0.54
40 0.52
41 0.52
42 0.58
43 0.62
44 0.61
45 0.61
46 0.56
47 0.56
48 0.54
49 0.49
50 0.45
51 0.39
52 0.4
53 0.39
54 0.41
55 0.4
56 0.42
57 0.46
58 0.43
59 0.46
60 0.42
61 0.38
62 0.38
63 0.37
64 0.32
65 0.28
66 0.27
67 0.23
68 0.27
69 0.26
70 0.24
71 0.22
72 0.21
73 0.19
74 0.19
75 0.17
76 0.14
77 0.14
78 0.12
79 0.12
80 0.12
81 0.11
82 0.12
83 0.12
84 0.13
85 0.13
86 0.15
87 0.23
88 0.25
89 0.26
90 0.26
91 0.28
92 0.26
93 0.32
94 0.33
95 0.27
96 0.3
97 0.31
98 0.35
99 0.37
100 0.38
101 0.33
102 0.39
103 0.41
104 0.4
105 0.4
106 0.37
107 0.37
108 0.37
109 0.36
110 0.32
111 0.26
112 0.22
113 0.23
114 0.21
115 0.17
116 0.18
117 0.18
118 0.15
119 0.14
120 0.14
121 0.1
122 0.12
123 0.13
124 0.18
125 0.2
126 0.21
127 0.22
128 0.22
129 0.21
130 0.2
131 0.19
132 0.12
133 0.1
134 0.14
135 0.13
136 0.16
137 0.2
138 0.24
139 0.28
140 0.3
141 0.31
142 0.31
143 0.39
144 0.44
145 0.46
146 0.52
147 0.51
148 0.53
149 0.56
150 0.53
151 0.5
152 0.45
153 0.41
154 0.35
155 0.34
156 0.32
157 0.28
158 0.28
159 0.24
160 0.2
161 0.17
162 0.13
163 0.11
164 0.09
165 0.07
166 0.06
167 0.05
168 0.05
169 0.06
170 0.08
171 0.09
172 0.1
173 0.1
174 0.1
175 0.12
176 0.2
177 0.25
178 0.31
179 0.36
180 0.44
181 0.54
182 0.63
183 0.66
184 0.69
185 0.73
186 0.75
187 0.8
188 0.82
189 0.79
190 0.8
191 0.84
192 0.84
193 0.8
194 0.74
195 0.65
196 0.58
197 0.55
198 0.47
199 0.38
200 0.31
201 0.26
202 0.23
203 0.25
204 0.23
205 0.21
206 0.23
207 0.22
208 0.19
209 0.21
210 0.23
211 0.21
212 0.27
213 0.32
214 0.36
215 0.47
216 0.57
217 0.64
218 0.68
219 0.76
220 0.8
221 0.83
222 0.85
223 0.84
224 0.84
225 0.82
226 0.8
227 0.72
228 0.72
229 0.68
230 0.68
231 0.69