Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RD22

Protein Details
Accession A0A1E5RD22    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
125-150FKESNEMNKKSKKRKNKDDIDSDYSAHydrophilic
NLS Segment(s)
PositionSequence
134-141KKSKKRKN
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSSRVMNMKFMQRKSNTGETTDTKENSENTEDEKLHIKDTSEWSFGARGKNSILATIRSKKLKSSNNKTPITLSQTVLNKKIHSQEASKDNLLIGKQKLGIKDELEKELEKAVXEEPKEKDLETLFKESNEMNKKSKKRKNKDDIDSDYSASKKTKLTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.53
4 0.48
5 0.51
6 0.45
7 0.49
8 0.49
9 0.43
10 0.36
11 0.36
12 0.34
13 0.32
14 0.32
15 0.26
16 0.24
17 0.29
18 0.27
19 0.25
20 0.31
21 0.28
22 0.27
23 0.27
24 0.24
25 0.23
26 0.29
27 0.32
28 0.26
29 0.25
30 0.25
31 0.27
32 0.28
33 0.29
34 0.23
35 0.2
36 0.2
37 0.24
38 0.23
39 0.23
40 0.21
41 0.2
42 0.24
43 0.29
44 0.32
45 0.32
46 0.33
47 0.34
48 0.41
49 0.46
50 0.51
51 0.55
52 0.61
53 0.66
54 0.67
55 0.63
56 0.58
57 0.52
58 0.49
59 0.41
60 0.31
61 0.27
62 0.3
63 0.32
64 0.33
65 0.31
66 0.24
67 0.24
68 0.27
69 0.25
70 0.23
71 0.23
72 0.24
73 0.28
74 0.31
75 0.29
76 0.25
77 0.23
78 0.22
79 0.2
80 0.19
81 0.15
82 0.13
83 0.16
84 0.18
85 0.2
86 0.21
87 0.22
88 0.2
89 0.25
90 0.26
91 0.24
92 0.25
93 0.23
94 0.22
95 0.22
96 0.2
97 0.14
98 0.14
99 0.15
100 0.19
101 0.2
102 0.22
103 0.23
104 0.25
105 0.25
106 0.25
107 0.23
108 0.23
109 0.25
110 0.29
111 0.26
112 0.24
113 0.25
114 0.25
115 0.32
116 0.35
117 0.35
118 0.38
119 0.46
120 0.56
121 0.65
122 0.74
123 0.77
124 0.79
125 0.87
126 0.9
127 0.91
128 0.92
129 0.91
130 0.89
131 0.85
132 0.77
133 0.67
134 0.59
135 0.5
136 0.43
137 0.34
138 0.29