Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5S271

Protein Details
Accession A0A1E5S271    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-21ADQRPTKRRNITQSNFNEQIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MADQRPTKRRNITQSNFNEQISYINPEQHLLQRTLTSIPHQSIEEARALNDNLASIGMKARQSVHVGYNRGLDNIKSMEEAKTTFLQNQPKINDNSQYTLPSYKRPIAPDEFDXDYRRVQTDIPGGYNQLIQQQYLQQQLQYQRDNNMLNXTPMFNRPXRNINTGFLMNNANLQHSNSNNPGIQGLEYTRTRSSVQESDIELERRLSEIDGHKDKMSEIDNAVQGTLDNMNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.74
4 0.65
5 0.55
6 0.44
7 0.4
8 0.32
9 0.3
10 0.22
11 0.23
12 0.23
13 0.23
14 0.25
15 0.28
16 0.29
17 0.25
18 0.25
19 0.22
20 0.24
21 0.25
22 0.24
23 0.22
24 0.22
25 0.22
26 0.22
27 0.22
28 0.22
29 0.22
30 0.23
31 0.22
32 0.18
33 0.17
34 0.18
35 0.18
36 0.17
37 0.14
38 0.12
39 0.09
40 0.09
41 0.09
42 0.06
43 0.08
44 0.1
45 0.1
46 0.11
47 0.13
48 0.15
49 0.17
50 0.19
51 0.24
52 0.27
53 0.28
54 0.28
55 0.31
56 0.29
57 0.28
58 0.26
59 0.2
60 0.17
61 0.16
62 0.15
63 0.12
64 0.13
65 0.12
66 0.13
67 0.13
68 0.13
69 0.14
70 0.14
71 0.16
72 0.2
73 0.27
74 0.29
75 0.34
76 0.33
77 0.36
78 0.39
79 0.38
80 0.38
81 0.32
82 0.31
83 0.27
84 0.26
85 0.22
86 0.24
87 0.23
88 0.22
89 0.24
90 0.25
91 0.27
92 0.27
93 0.3
94 0.29
95 0.3
96 0.29
97 0.31
98 0.29
99 0.27
100 0.27
101 0.24
102 0.21
103 0.2
104 0.18
105 0.13
106 0.13
107 0.16
108 0.15
109 0.15
110 0.15
111 0.14
112 0.14
113 0.14
114 0.13
115 0.13
116 0.12
117 0.11
118 0.11
119 0.14
120 0.16
121 0.19
122 0.19
123 0.15
124 0.18
125 0.25
126 0.29
127 0.3
128 0.29
129 0.27
130 0.32
131 0.32
132 0.29
133 0.27
134 0.23
135 0.2
136 0.2
137 0.2
138 0.24
139 0.27
140 0.29
141 0.28
142 0.31
143 0.33
144 0.38
145 0.38
146 0.33
147 0.29
148 0.31
149 0.29
150 0.26
151 0.25
152 0.19
153 0.2
154 0.17
155 0.18
156 0.14
157 0.15
158 0.17
159 0.17
160 0.21
161 0.2
162 0.24
163 0.22
164 0.22
165 0.21
166 0.18
167 0.17
168 0.14
169 0.13
170 0.16
171 0.16
172 0.19
173 0.19
174 0.21
175 0.22
176 0.23
177 0.27
178 0.26
179 0.28
180 0.28
181 0.29
182 0.31
183 0.34
184 0.34
185 0.28
186 0.25
187 0.23
188 0.19
189 0.18
190 0.16
191 0.17
192 0.22
193 0.31
194 0.35
195 0.37
196 0.37
197 0.37
198 0.37
199 0.36
200 0.31
201 0.26
202 0.23
203 0.25
204 0.27
205 0.27
206 0.26
207 0.21
208 0.19
209 0.17