Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RQ67

Protein Details
Accession A0A1E5RQ67    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
363-387ITIPKFEKLIKKNYKQRVLKFDSLTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, cyto 10, nucl 9, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002376  Formyl_transf_N  
IPR036477  Formyl_transf_N_sf  
Gene Ontology GO:0016740  F:transferase activity  
GO:0009058  P:biosynthetic process  
Pfam View protein in Pfam  
PF00551  Formyl_trans_N  
Amino Acid Sequences MRILFLGSDDFSTSILKTITKFPKLKVDVLGPSADTVFYNNKHIKTQVIPKIIEYSSSNNLTYSQDINTYKQDILDRKYDMLITASFNAFIDKTIINKFPMNRCINIHPSLLPYYKGAAPIQRTLLDNAKYTGVTIQTLHXDKFDHGKILLQSSPILTDTLCNDFDKKISWKSIYKMNSIFIKKEETFNEEDNKYRLKQNDDKTGIYFNEKYSHLRNSLTIVGSKLMHELFNNDNYMHIQPCENNKLICGEKLENKKFSSKLTILDFDIDWNSKTASELEYIGNITNEKIYTYFKKVPIKNRTKQPWIPEKIFLXNLKSLDRYEPINDDCEVGXFEIKENKIVIKCKSNTYIECGGVRPADKPDFITIPKFEKLIKKNYKQRVLKFDSLTDVXXEYKDLKSNDDSGVVRIAAVEDMIRLKASSKNKSKYKTLYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.15
5 0.25
6 0.33
7 0.41
8 0.44
9 0.45
10 0.55
11 0.58
12 0.6
13 0.55
14 0.53
15 0.48
16 0.47
17 0.45
18 0.34
19 0.31
20 0.27
21 0.22
22 0.16
23 0.14
24 0.18
25 0.18
26 0.26
27 0.31
28 0.32
29 0.35
30 0.37
31 0.38
32 0.39
33 0.48
34 0.48
35 0.5
36 0.48
37 0.46
38 0.51
39 0.46
40 0.42
41 0.35
42 0.31
43 0.31
44 0.33
45 0.31
46 0.26
47 0.27
48 0.26
49 0.26
50 0.23
51 0.18
52 0.22
53 0.24
54 0.26
55 0.28
56 0.29
57 0.27
58 0.28
59 0.33
60 0.31
61 0.33
62 0.36
63 0.35
64 0.33
65 0.34
66 0.31
67 0.26
68 0.22
69 0.2
70 0.16
71 0.17
72 0.15
73 0.14
74 0.14
75 0.15
76 0.12
77 0.11
78 0.12
79 0.1
80 0.13
81 0.17
82 0.19
83 0.2
84 0.24
85 0.29
86 0.33
87 0.42
88 0.42
89 0.41
90 0.43
91 0.46
92 0.48
93 0.46
94 0.41
95 0.32
96 0.32
97 0.33
98 0.31
99 0.26
100 0.21
101 0.2
102 0.2
103 0.22
104 0.2
105 0.2
106 0.22
107 0.24
108 0.26
109 0.25
110 0.25
111 0.26
112 0.3
113 0.28
114 0.26
115 0.24
116 0.23
117 0.2
118 0.19
119 0.18
120 0.13
121 0.12
122 0.11
123 0.12
124 0.19
125 0.19
126 0.2
127 0.19
128 0.2
129 0.2
130 0.23
131 0.25
132 0.17
133 0.2
134 0.2
135 0.23
136 0.22
137 0.21
138 0.18
139 0.14
140 0.15
141 0.12
142 0.11
143 0.08
144 0.08
145 0.09
146 0.12
147 0.13
148 0.12
149 0.13
150 0.13
151 0.14
152 0.17
153 0.18
154 0.19
155 0.22
156 0.26
157 0.28
158 0.3
159 0.37
160 0.36
161 0.37
162 0.35
163 0.34
164 0.37
165 0.36
166 0.35
167 0.28
168 0.31
169 0.28
170 0.3
171 0.28
172 0.25
173 0.26
174 0.28
175 0.31
176 0.26
177 0.27
178 0.25
179 0.26
180 0.24
181 0.25
182 0.26
183 0.28
184 0.35
185 0.39
186 0.47
187 0.48
188 0.47
189 0.44
190 0.44
191 0.37
192 0.33
193 0.28
194 0.19
195 0.19
196 0.19
197 0.21
198 0.21
199 0.23
200 0.21
201 0.21
202 0.21
203 0.19
204 0.21
205 0.19
206 0.17
207 0.14
208 0.13
209 0.13
210 0.13
211 0.11
212 0.09
213 0.09
214 0.08
215 0.11
216 0.11
217 0.13
218 0.14
219 0.12
220 0.12
221 0.14
222 0.15
223 0.12
224 0.11
225 0.1
226 0.12
227 0.17
228 0.21
229 0.2
230 0.19
231 0.19
232 0.22
233 0.22
234 0.2
235 0.19
236 0.18
237 0.23
238 0.33
239 0.37
240 0.37
241 0.38
242 0.41
243 0.39
244 0.39
245 0.39
246 0.3
247 0.3
248 0.3
249 0.31
250 0.26
251 0.27
252 0.24
253 0.18
254 0.18
255 0.15
256 0.12
257 0.1
258 0.1
259 0.09
260 0.09
261 0.09
262 0.09
263 0.09
264 0.11
265 0.1
266 0.11
267 0.11
268 0.11
269 0.1
270 0.09
271 0.09
272 0.08
273 0.08
274 0.08
275 0.08
276 0.12
277 0.15
278 0.23
279 0.28
280 0.34
281 0.43
282 0.48
283 0.57
284 0.64
285 0.7
286 0.71
287 0.76
288 0.78
289 0.78
290 0.77
291 0.76
292 0.76
293 0.73
294 0.68
295 0.63
296 0.57
297 0.53
298 0.54
299 0.45
300 0.39
301 0.35
302 0.33
303 0.31
304 0.31
305 0.27
306 0.23
307 0.24
308 0.23
309 0.24
310 0.23
311 0.22
312 0.21
313 0.21
314 0.19
315 0.18
316 0.17
317 0.13
318 0.11
319 0.11
320 0.14
321 0.14
322 0.16
323 0.15
324 0.18
325 0.22
326 0.27
327 0.3
328 0.36
329 0.38
330 0.41
331 0.47
332 0.49
333 0.46
334 0.48
335 0.49
336 0.42
337 0.41
338 0.36
339 0.32
340 0.28
341 0.27
342 0.23
343 0.23
344 0.24
345 0.23
346 0.25
347 0.27
348 0.28
349 0.3
350 0.33
351 0.3
352 0.32
353 0.33
354 0.32
355 0.32
356 0.37
357 0.42
358 0.48
359 0.55
360 0.6
361 0.69
362 0.78
363 0.84
364 0.83
365 0.85
366 0.85
367 0.83
368 0.81
369 0.74
370 0.66
371 0.62
372 0.54
373 0.48
374 0.39
375 0.32
376 0.26
377 0.25
378 0.24
379 0.24
380 0.23
381 0.24
382 0.24
383 0.27
384 0.26
385 0.29
386 0.29
387 0.25
388 0.27
389 0.24
390 0.21
391 0.17
392 0.16
393 0.11
394 0.1
395 0.09
396 0.07
397 0.09
398 0.1
399 0.1
400 0.1
401 0.12
402 0.19
403 0.28
404 0.37
405 0.45
406 0.55
407 0.63
408 0.7
409 0.77