Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RU30

Protein Details
Accession A0A1E5RU30   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCMNCHydrophilic
82-110RIVRVRSRVNRKIRAPPRRQRFNKAADKVHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
87-105RSRVNRKIRAPPRRQRFNK
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCMNCSKSVPKDKAIKRVQVKNIVENAAIRDLSEASVYNEYALPRVYVKNHYCVSCAIHARIVRVRSRVNRKIRAPPRRQRFNKAADKVSPEGAAAAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.67
11 0.61
12 0.62
13 0.58
14 0.54
15 0.55
16 0.58
17 0.59
18 0.61
19 0.66
20 0.61
21 0.66
22 0.67
23 0.65
24 0.64
25 0.69
26 0.68
27 0.68
28 0.65
29 0.6
30 0.56
31 0.49
32 0.41
33 0.33
34 0.28
35 0.2
36 0.18
37 0.12
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.09
54 0.11
55 0.17
56 0.19
57 0.25
58 0.27
59 0.27
60 0.27
61 0.27
62 0.27
63 0.25
64 0.26
65 0.21
66 0.22
67 0.23
68 0.25
69 0.28
70 0.29
71 0.27
72 0.29
73 0.35
74 0.41
75 0.5
76 0.57
77 0.62
78 0.67
79 0.7
80 0.76
81 0.8
82 0.82
83 0.82
84 0.83
85 0.84
86 0.86
87 0.87
88 0.85
89 0.84
90 0.83
91 0.83
92 0.8
93 0.76
94 0.7
95 0.7
96 0.63
97 0.56
98 0.46
99 0.36
100 0.29