Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RCW2

Protein Details
Accession A0A1E5RCW2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
117-138IFKPYNSKKKVNKKDQQTRESIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006578  MADF-dom  
Pfam View protein in Pfam  
PF10545  MADF_DNA_bdg  
Amino Acid Sequences MNLPIECTSKKIERIKQDIKFIKLCIKNKDLLKEYHHKKYKSEFWKKVCFEYNFHIKGLHKTCKQLRDKFKYIYRSYNTIGNNTKSXNNDIKELEFMLKQELDVCFSFISYDQDGTLIFKPYNSKKKVNKKDQQTRESITDYENTLVNNPIFFNPSVRSSVSLSNVTNSTNDTTLPESEDIVTQQDIIDSIHFDSFPIYQSYINYKNHETTPENPDLSKSFKFIEELKTKSYSLHDFETFSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.73
4 0.78
5 0.76
6 0.73
7 0.69
8 0.61
9 0.61
10 0.59
11 0.6
12 0.57
13 0.54
14 0.55
15 0.56
16 0.62
17 0.58
18 0.54
19 0.55
20 0.58
21 0.61
22 0.64
23 0.68
24 0.61
25 0.61
26 0.66
27 0.68
28 0.69
29 0.73
30 0.72
31 0.71
32 0.8
33 0.77
34 0.74
35 0.73
36 0.65
37 0.57
38 0.55
39 0.58
40 0.49
41 0.47
42 0.44
43 0.36
44 0.42
45 0.46
46 0.47
47 0.4
48 0.47
49 0.53
50 0.59
51 0.67
52 0.67
53 0.7
54 0.71
55 0.74
56 0.73
57 0.73
58 0.73
59 0.68
60 0.67
61 0.6
62 0.56
63 0.51
64 0.5
65 0.44
66 0.41
67 0.42
68 0.35
69 0.34
70 0.31
71 0.3
72 0.27
73 0.29
74 0.24
75 0.23
76 0.22
77 0.2
78 0.22
79 0.21
80 0.2
81 0.17
82 0.16
83 0.15
84 0.13
85 0.12
86 0.11
87 0.1
88 0.12
89 0.11
90 0.12
91 0.09
92 0.09
93 0.1
94 0.08
95 0.11
96 0.08
97 0.09
98 0.08
99 0.08
100 0.08
101 0.1
102 0.11
103 0.09
104 0.09
105 0.09
106 0.14
107 0.21
108 0.3
109 0.33
110 0.4
111 0.48
112 0.59
113 0.69
114 0.75
115 0.76
116 0.78
117 0.84
118 0.85
119 0.81
120 0.75
121 0.67
122 0.6
123 0.54
124 0.44
125 0.34
126 0.26
127 0.22
128 0.18
129 0.15
130 0.12
131 0.11
132 0.12
133 0.11
134 0.1
135 0.1
136 0.09
137 0.11
138 0.11
139 0.12
140 0.12
141 0.14
142 0.16
143 0.16
144 0.17
145 0.17
146 0.2
147 0.21
148 0.22
149 0.2
150 0.2
151 0.2
152 0.19
153 0.17
154 0.16
155 0.14
156 0.12
157 0.12
158 0.12
159 0.13
160 0.13
161 0.15
162 0.14
163 0.13
164 0.13
165 0.13
166 0.12
167 0.12
168 0.11
169 0.09
170 0.08
171 0.08
172 0.08
173 0.07
174 0.07
175 0.07
176 0.08
177 0.09
178 0.08
179 0.08
180 0.09
181 0.09
182 0.11
183 0.12
184 0.12
185 0.12
186 0.14
187 0.21
188 0.27
189 0.31
190 0.33
191 0.34
192 0.37
193 0.38
194 0.43
195 0.4
196 0.38
197 0.41
198 0.44
199 0.42
200 0.39
201 0.39
202 0.36
203 0.38
204 0.34
205 0.28
206 0.24
207 0.24
208 0.27
209 0.27
210 0.34
211 0.36
212 0.38
213 0.4
214 0.41
215 0.4
216 0.4
217 0.42
218 0.38
219 0.35
220 0.37
221 0.35
222 0.34