Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5R6V3

Protein Details
Accession A0A1E5R6V3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-111EILHKRLNQKRIDRLRRKEKRNKALSEGRKRBasic
NLS Segment(s)
PositionSequence
27-111IKKSSWDKKKEEALKEKEFKDKLAQMKQEKQDLKQEKLNARKEREEKRIEKERLEILHKRLNQKRIDRLRRKEKRNKALSEGRKR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MDGNNKSNRSWKAYKVTKSLKPNNAIIKKSSWDKKKEEALKEKEFKDKLAQMKQEKQDLKQEKLNARKEREEKRIEKERLEILHKRLNQKRIDRLRRKEKRNKALSEGRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.68
3 0.72
4 0.71
5 0.76
6 0.78
7 0.76
8 0.71
9 0.71
10 0.71
11 0.7
12 0.64
13 0.56
14 0.49
15 0.46
16 0.49
17 0.51
18 0.49
19 0.49
20 0.52
21 0.56
22 0.62
23 0.66
24 0.66
25 0.68
26 0.68
27 0.7
28 0.7
29 0.66
30 0.64
31 0.56
32 0.49
33 0.44
34 0.42
35 0.4
36 0.41
37 0.45
38 0.43
39 0.5
40 0.51
41 0.53
42 0.49
43 0.44
44 0.47
45 0.45
46 0.44
47 0.41
48 0.43
49 0.43
50 0.5
51 0.58
52 0.55
53 0.55
54 0.59
55 0.63
56 0.65
57 0.67
58 0.67
59 0.63
60 0.64
61 0.7
62 0.65
63 0.6
64 0.55
65 0.52
66 0.48
67 0.49
68 0.46
69 0.41
70 0.46
71 0.48
72 0.54
73 0.55
74 0.59
75 0.61
76 0.63
77 0.68
78 0.72
79 0.79
80 0.8
81 0.83
82 0.87
83 0.89
84 0.92
85 0.92
86 0.92
87 0.92
88 0.91
89 0.87
90 0.85
91 0.86