Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H2ASR2

Protein Details
Accession H2ASR2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-101ELELRRKQLRKLNRDKIKQKNFLSELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG kaf:KAFR_0C04210  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRLSRRFFSHSRSVLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIQELELRRKQLRKLNRDKIKQKNFLSEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.5
4 0.46
5 0.39
6 0.38
7 0.33
8 0.29
9 0.24
10 0.22
11 0.24
12 0.25
13 0.23
14 0.2
15 0.21
16 0.22
17 0.22
18 0.2
19 0.18
20 0.18
21 0.2
22 0.21
23 0.26
24 0.34
25 0.39
26 0.43
27 0.48
28 0.46
29 0.47
30 0.51
31 0.51
32 0.46
33 0.41
34 0.37
35 0.33
36 0.31
37 0.28
38 0.24
39 0.17
40 0.13
41 0.13
42 0.11
43 0.07
44 0.06
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.11
51 0.14
52 0.15
53 0.12
54 0.12
55 0.12
56 0.14
57 0.15
58 0.14
59 0.15
60 0.14
61 0.16
62 0.2
63 0.2
64 0.28
65 0.33
66 0.37
67 0.39
68 0.44
69 0.49
70 0.53
71 0.62
72 0.64
73 0.69
74 0.74
75 0.79
76 0.85
77 0.89
78 0.91
79 0.91
80 0.9
81 0.84