Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RJG8

Protein Details
Accession A0A1E5RJG8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-43VNKQTNPKIRKANQKFEKQNKDVRKHGKSKVKKSNQADKPHydrophilic
NLS Segment(s)
PositionSequence
11-37KIRKANQKFEKQNKDVRKHGKSKVKKS
Subcellular Location(s) plas 7, extr 7, nucl 3.5, cyto_nucl 3.5, mito 3, E.R. 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAGVNKQTNPKIRKANQKFEKQNKDVRKHGKSKVKKSNQADKPALSKFWIYLLAFLIVGGGLLEILALLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.77
4 0.83
5 0.85
6 0.86
7 0.88
8 0.81
9 0.81
10 0.8
11 0.78
12 0.76
13 0.75
14 0.73
15 0.7
16 0.74
17 0.75
18 0.74
19 0.78
20 0.8
21 0.8
22 0.8
23 0.8
24 0.82
25 0.78
26 0.77
27 0.7
28 0.61
29 0.57
30 0.5
31 0.43
32 0.34
33 0.27
34 0.19
35 0.18
36 0.2
37 0.15
38 0.15
39 0.15
40 0.14
41 0.14
42 0.13
43 0.11
44 0.07
45 0.06
46 0.05
47 0.03
48 0.02
49 0.02
50 0.02