Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5S0C6

Protein Details
Accession A0A1E5S0C6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
325-356DTNNNFTGEQKLKKKNKRKINRQGNNSSRNDNHydrophilic
NLS Segment(s)
PositionSequence
337-347KLKKKNKRKIN
Subcellular Location(s) nucl 15cyto_nucl 15, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR004854  Ufd1-like  
IPR042299  Ufd1-like_Nn  
Gene Ontology GO:0050896  P:response to stimulus  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF03152  UFD1  
Amino Acid Sequences MFNTFPSFNQGMQFNYMPESSEFKENYRLYPVSYLPNNVSAEKKKSLNHSGKIILPPSALTKLSFLEISYPMLFEIQSNVSFKLTNAGVLEFIAEEGRVYLPDWIIDQLEAPITSTVTIKSVTLPKATFVKLEPQSVDFLEIENPKVVLENCLRNYSVLKLDDIIHIDFNGNLYKIKITDLKPNXQGSCIVETDLVTDFDPPKGYVEPDYKKMKEDKEREEEEKKKNMVEKDPSINSMSKRLFIPALNKPLNGADSFKSDGVKLNGKKVDIEKDTKKIIDTVKTHNDLRQIVSNNEIKPFPLEDGVLFFGFPYIPPKKDDLVDEVDTNNNFTGEXQKLKKKNKRKINRQGNNSSRNDXNGDPEHETRKSPRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.22
5 0.21
6 0.24
7 0.22
8 0.28
9 0.29
10 0.29
11 0.38
12 0.37
13 0.38
14 0.4
15 0.38
16 0.33
17 0.36
18 0.36
19 0.35
20 0.36
21 0.37
22 0.32
23 0.37
24 0.37
25 0.34
26 0.38
27 0.36
28 0.4
29 0.42
30 0.44
31 0.43
32 0.49
33 0.57
34 0.6
35 0.58
36 0.58
37 0.57
38 0.57
39 0.58
40 0.51
41 0.42
42 0.33
43 0.29
44 0.27
45 0.26
46 0.22
47 0.18
48 0.18
49 0.17
50 0.18
51 0.17
52 0.13
53 0.14
54 0.14
55 0.17
56 0.15
57 0.15
58 0.13
59 0.13
60 0.13
61 0.1
62 0.12
63 0.11
64 0.13
65 0.15
66 0.15
67 0.16
68 0.16
69 0.16
70 0.17
71 0.15
72 0.15
73 0.14
74 0.13
75 0.13
76 0.12
77 0.12
78 0.07
79 0.07
80 0.06
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.06
87 0.07
88 0.07
89 0.08
90 0.09
91 0.09
92 0.09
93 0.08
94 0.08
95 0.07
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.08
106 0.07
107 0.1
108 0.16
109 0.17
110 0.19
111 0.19
112 0.2
113 0.24
114 0.24
115 0.22
116 0.18
117 0.25
118 0.25
119 0.27
120 0.26
121 0.23
122 0.24
123 0.23
124 0.24
125 0.15
126 0.13
127 0.14
128 0.14
129 0.14
130 0.13
131 0.13
132 0.1
133 0.12
134 0.11
135 0.12
136 0.14
137 0.19
138 0.21
139 0.23
140 0.23
141 0.22
142 0.23
143 0.21
144 0.21
145 0.16
146 0.15
147 0.14
148 0.15
149 0.16
150 0.17
151 0.15
152 0.11
153 0.1
154 0.1
155 0.09
156 0.09
157 0.08
158 0.07
159 0.06
160 0.07
161 0.07
162 0.07
163 0.09
164 0.14
165 0.15
166 0.24
167 0.27
168 0.33
169 0.36
170 0.36
171 0.35
172 0.31
173 0.3
174 0.21
175 0.2
176 0.14
177 0.11
178 0.11
179 0.11
180 0.1
181 0.1
182 0.1
183 0.08
184 0.09
185 0.09
186 0.1
187 0.09
188 0.09
189 0.09
190 0.1
191 0.13
192 0.19
193 0.22
194 0.27
195 0.34
196 0.33
197 0.35
198 0.39
199 0.43
200 0.45
201 0.5
202 0.51
203 0.53
204 0.57
205 0.6
206 0.63
207 0.64
208 0.61
209 0.61
210 0.55
211 0.49
212 0.5
213 0.49
214 0.47
215 0.46
216 0.44
217 0.43
218 0.43
219 0.42
220 0.39
221 0.38
222 0.32
223 0.33
224 0.29
225 0.24
226 0.24
227 0.23
228 0.23
229 0.22
230 0.27
231 0.26
232 0.35
233 0.34
234 0.33
235 0.33
236 0.32
237 0.31
238 0.26
239 0.21
240 0.14
241 0.16
242 0.18
243 0.18
244 0.17
245 0.16
246 0.19
247 0.21
248 0.28
249 0.26
250 0.32
251 0.34
252 0.33
253 0.36
254 0.36
255 0.4
256 0.37
257 0.42
258 0.4
259 0.42
260 0.45
261 0.43
262 0.4
263 0.37
264 0.36
265 0.37
266 0.36
267 0.39
268 0.44
269 0.48
270 0.48
271 0.46
272 0.47
273 0.41
274 0.4
275 0.39
276 0.34
277 0.3
278 0.35
279 0.38
280 0.33
281 0.34
282 0.31
283 0.25
284 0.24
285 0.24
286 0.2
287 0.16
288 0.15
289 0.13
290 0.16
291 0.17
292 0.15
293 0.13
294 0.12
295 0.11
296 0.1
297 0.1
298 0.15
299 0.17
300 0.19
301 0.22
302 0.26
303 0.28
304 0.31
305 0.33
306 0.31
307 0.33
308 0.34
309 0.33
310 0.31
311 0.32
312 0.29
313 0.28
314 0.23
315 0.16
316 0.14
317 0.14
318 0.2
319 0.23
320 0.32
321 0.4
322 0.5
323 0.61
324 0.71
325 0.81
326 0.83
327 0.87
328 0.9
329 0.92
330 0.93
331 0.94
332 0.93
333 0.92
334 0.94
335 0.93
336 0.91
337 0.85
338 0.78
339 0.7
340 0.66
341 0.58
342 0.51
343 0.44
344 0.39
345 0.4
346 0.4
347 0.44
348 0.39
349 0.42