Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RYS0

Protein Details
Accession A0A1E5RYS0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKKKSSRKPVKKVRVVLDTSHydrophilic
NLS Segment(s)
PositionSequence
3-13KKKSSRKPVKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MAKKKSSRKPVKKVRVVLDTSFDCPFCNHNXCITVSVDKRISMIGTLHCNKCNVSFETKVNVLSDPVDVYTDWIDAVEAVNDPKALNDSGSRKEIDSDSDSDLYDTDDDDVETDXKSAXVDDEGESDFSEADDNSNQNLTSDEEDIEDQHVVKKRKIVIEDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.79
4 0.7
5 0.65
6 0.56
7 0.5
8 0.43
9 0.35
10 0.26
11 0.23
12 0.25
13 0.22
14 0.24
15 0.21
16 0.23
17 0.24
18 0.26
19 0.29
20 0.32
21 0.31
22 0.31
23 0.32
24 0.28
25 0.27
26 0.25
27 0.22
28 0.16
29 0.15
30 0.13
31 0.2
32 0.25
33 0.28
34 0.29
35 0.29
36 0.28
37 0.29
38 0.31
39 0.26
40 0.26
41 0.27
42 0.27
43 0.3
44 0.3
45 0.28
46 0.24
47 0.22
48 0.17
49 0.14
50 0.12
51 0.08
52 0.08
53 0.07
54 0.06
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.04
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.06
71 0.05
72 0.06
73 0.09
74 0.13
75 0.15
76 0.17
77 0.18
78 0.17
79 0.18
80 0.18
81 0.18
82 0.18
83 0.17
84 0.18
85 0.18
86 0.18
87 0.16
88 0.16
89 0.13
90 0.1
91 0.08
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.06
102 0.07
103 0.06
104 0.06
105 0.05
106 0.06
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.07
113 0.08
114 0.07
115 0.08
116 0.09
117 0.1
118 0.11
119 0.12
120 0.12
121 0.12
122 0.13
123 0.13
124 0.14
125 0.14
126 0.13
127 0.14
128 0.15
129 0.15
130 0.16
131 0.14
132 0.12
133 0.16
134 0.24
135 0.26
136 0.28
137 0.34
138 0.38
139 0.44
140 0.48
141 0.48