Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RK67

Protein Details
Accession A0A1E5RK67    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-63TKQRRRSSVNTKPKVHKPKPBasic
95-122DDGFEEKSNKKKKNKVIKARPNNKNLGSHydrophilic
NLS Segment(s)
PositionSequence
54-62TKPKVHKPK
102-120SNKKKKNXKXVIKARPNNK
Subcellular Location(s) nucl 17, cyto_nucl 13.833, mito_nucl 9.499, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031456  Caf20  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005845  C:mRNA cap binding complex  
GO:0003743  F:translation initiation factor activity  
GO:0017148  P:negative regulation of translation  
Pfam View protein in Pfam  
PF17052  CAF20  
Amino Acid Sequences MSDTIHLYSYQEILDLKSNAVLPEGFDLTDFTVEYETRLANNLTKQRRRSSVNTKPKVHKPKPRVSVDESGWSTVVVDPIEGETDEAVVEASPVDDGFEEKSNKKKKNXKXVIKARPNNKNLGSSKAADGKDIQEGMKKAFNAFDALALEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.17
5 0.18
6 0.17
7 0.18
8 0.16
9 0.11
10 0.13
11 0.14
12 0.11
13 0.1
14 0.11
15 0.11
16 0.11
17 0.1
18 0.08
19 0.08
20 0.09
21 0.09
22 0.1
23 0.09
24 0.09
25 0.11
26 0.11
27 0.13
28 0.19
29 0.27
30 0.35
31 0.42
32 0.46
33 0.51
34 0.56
35 0.59
36 0.61
37 0.64
38 0.65
39 0.69
40 0.73
41 0.74
42 0.75
43 0.79
44 0.82
45 0.8
46 0.78
47 0.76
48 0.77
49 0.79
50 0.78
51 0.73
52 0.67
53 0.65
54 0.57
55 0.54
56 0.45
57 0.37
58 0.31
59 0.25
60 0.2
61 0.14
62 0.13
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.05
69 0.04
70 0.03
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.06
85 0.1
86 0.13
87 0.15
88 0.24
89 0.33
90 0.42
91 0.5
92 0.57
93 0.63
94 0.72
95 0.81
96 0.83
97 0.86
98 0.89
99 0.92
100 0.94
101 0.92
102 0.88
103 0.85
104 0.76
105 0.73
106 0.64
107 0.59
108 0.52
109 0.45
110 0.42
111 0.42
112 0.39
113 0.32
114 0.31
115 0.27
116 0.27
117 0.27
118 0.23
119 0.22
120 0.23
121 0.25
122 0.28
123 0.26
124 0.23
125 0.24
126 0.24
127 0.22
128 0.21
129 0.2
130 0.17
131 0.17