Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5R9V0

Protein Details
Accession A0A1E5R9V0   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
251-276NVSSNFKKDLKQKLKDFKSKKQTEELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR008162  Pyrophosphatase  
IPR036649  Pyrophosphatase_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0004427  F:inorganic diphosphate phosphatase activity  
GO:0000287  F:magnesium ion binding  
GO:0006796  P:phosphate-containing compound metabolic process  
Pfam View protein in Pfam  
PF00719  Pyrophosphatase  
PROSITE View protein in PROSITE  
PS00387  PPASE  
CDD cd00412  pyrophosphatase  
Amino Acid Sequences MFKANFKLLNKAILGSKYTPEYKIYYKNPVTSELGSFFHDIPLKSEKDNDLYNMVVEIPQHTNPKYEVSKTDILNPIIQDTKKGKMRFINNLFPHKGYIATYGSIPQTWEDPAMEGDNDPLDVLDISTGRKLETGDIQQVKILGSLGLIDDGEIDWKIISISNQSSDFGKVNSLDDVDKIYPGLLKSIRFWFENYKVNNEQKNQFLHDGRFLNKEETLSIIKECHLSWKKLMSKSEVEMNIKDPVIFTEKNVSSNFKKDLKQKLKDFKSKKQTEELAEEDIEGYDGKWYFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.31
4 0.31
5 0.33
6 0.32
7 0.31
8 0.33
9 0.35
10 0.42
11 0.44
12 0.48
13 0.5
14 0.54
15 0.53
16 0.53
17 0.51
18 0.44
19 0.42
20 0.35
21 0.31
22 0.28
23 0.28
24 0.23
25 0.23
26 0.24
27 0.21
28 0.22
29 0.27
30 0.26
31 0.25
32 0.29
33 0.28
34 0.29
35 0.3
36 0.28
37 0.25
38 0.23
39 0.22
40 0.19
41 0.16
42 0.13
43 0.11
44 0.12
45 0.13
46 0.16
47 0.2
48 0.2
49 0.23
50 0.23
51 0.29
52 0.3
53 0.29
54 0.29
55 0.31
56 0.36
57 0.34
58 0.4
59 0.39
60 0.37
61 0.37
62 0.34
63 0.3
64 0.29
65 0.28
66 0.26
67 0.23
68 0.3
69 0.34
70 0.35
71 0.37
72 0.4
73 0.46
74 0.51
75 0.55
76 0.57
77 0.56
78 0.62
79 0.6
80 0.53
81 0.48
82 0.38
83 0.32
84 0.23
85 0.21
86 0.15
87 0.14
88 0.13
89 0.14
90 0.14
91 0.13
92 0.13
93 0.1
94 0.09
95 0.09
96 0.1
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.07
105 0.07
106 0.06
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.08
120 0.11
121 0.13
122 0.18
123 0.19
124 0.19
125 0.19
126 0.19
127 0.18
128 0.15
129 0.12
130 0.06
131 0.04
132 0.04
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.05
147 0.07
148 0.08
149 0.1
150 0.1
151 0.11
152 0.12
153 0.13
154 0.14
155 0.11
156 0.12
157 0.1
158 0.11
159 0.1
160 0.11
161 0.09
162 0.09
163 0.11
164 0.1
165 0.1
166 0.09
167 0.08
168 0.09
169 0.09
170 0.12
171 0.11
172 0.12
173 0.15
174 0.2
175 0.22
176 0.21
177 0.23
178 0.26
179 0.29
180 0.36
181 0.35
182 0.37
183 0.42
184 0.47
185 0.5
186 0.48
187 0.47
188 0.44
189 0.45
190 0.42
191 0.4
192 0.37
193 0.34
194 0.35
195 0.35
196 0.32
197 0.33
198 0.32
199 0.29
200 0.27
201 0.26
202 0.2
203 0.2
204 0.2
205 0.17
206 0.16
207 0.15
208 0.14
209 0.15
210 0.15
211 0.22
212 0.25
213 0.27
214 0.29
215 0.38
216 0.44
217 0.49
218 0.52
219 0.47
220 0.46
221 0.46
222 0.51
223 0.47
224 0.43
225 0.39
226 0.38
227 0.35
228 0.31
229 0.29
230 0.21
231 0.18
232 0.21
233 0.2
234 0.19
235 0.25
236 0.26
237 0.3
238 0.31
239 0.35
240 0.33
241 0.39
242 0.44
243 0.4
244 0.45
245 0.5
246 0.59
247 0.64
248 0.69
249 0.73
250 0.78
251 0.82
252 0.86
253 0.86
254 0.86
255 0.86
256 0.85
257 0.8
258 0.79
259 0.75
260 0.71
261 0.7
262 0.62
263 0.55
264 0.47
265 0.42
266 0.33
267 0.26
268 0.21
269 0.14
270 0.11
271 0.11