Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5S0R1

Protein Details
Accession A0A1E5S0R1   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-37INVPKTRKTYCKGKQCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVFPTIINVPKTRKTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQSGFGGQTKQIFHKKAKTTKKVVLKLECVECKTKAQLALKRCKHFELGGERKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.64
4 0.7
5 0.73
6 0.79
7 0.83
8 0.85
9 0.9
10 0.89
11 0.91
12 0.91
13 0.9
14 0.88
15 0.89
16 0.89
17 0.81
18 0.81
19 0.74
20 0.68
21 0.61
22 0.53
23 0.42
24 0.34
25 0.33
26 0.31
27 0.33
28 0.31
29 0.34
30 0.4
31 0.43
32 0.47
33 0.51
34 0.51
35 0.55
36 0.61
37 0.59
38 0.6
39 0.59
40 0.6
41 0.57
42 0.53
43 0.46
44 0.39
45 0.36
46 0.29
47 0.32
48 0.31
49 0.3
50 0.31
51 0.36
52 0.41
53 0.48
54 0.57
55 0.61
56 0.62
57 0.66
58 0.73
59 0.72
60 0.71
61 0.67
62 0.61
63 0.58
64 0.58
65 0.53
66 0.46
67 0.42
68 0.37
69 0.34
70 0.32
71 0.3
72 0.3
73 0.35
74 0.38
75 0.43
76 0.53
77 0.59
78 0.63
79 0.62
80 0.59
81 0.54
82 0.51
83 0.49
84 0.5
85 0.5
86 0.53
87 0.59
88 0.57
89 0.56
90 0.59
91 0.55