Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5S142

Protein Details
Accession A0A1E5S142    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
234-260DTGSEATKQSKKQKKSKNRRVVMDASIHydrophilic
NLS Segment(s)
PositionSequence
242-254KQSKKQKKSKNRR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDEKXDSLLKQTYNEFNIELDNSHIKNIASSISSKHLKMIKLVAVYTTARKQENPIQRLQILYKGKNTFDWLNDTEGDYYKLYQYYKKKLNVMLNENGKIFTLKTDEHRIDSRHPLYKQIFYEKLYHLSLLNTKNLENKLKLIENDNFELYYKYINESIDWYKILATEDTENKNVTRIELPSIEKVLPKLTDISLNYNLDVNKLKLMKNNIDKENEINKYFKTDIMAIVKKRKVDTGSEATKQSKKQKKSKNRRVVMDASISRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.28
4 0.28
5 0.21
6 0.18
7 0.22
8 0.2
9 0.21
10 0.22
11 0.2
12 0.19
13 0.2
14 0.17
15 0.13
16 0.14
17 0.16
18 0.22
19 0.25
20 0.25
21 0.3
22 0.33
23 0.32
24 0.34
25 0.36
26 0.33
27 0.32
28 0.32
29 0.27
30 0.25
31 0.26
32 0.27
33 0.26
34 0.26
35 0.25
36 0.26
37 0.31
38 0.37
39 0.45
40 0.45
41 0.45
42 0.46
43 0.45
44 0.47
45 0.43
46 0.42
47 0.39
48 0.38
49 0.4
50 0.38
51 0.38
52 0.37
53 0.4
54 0.35
55 0.3
56 0.33
57 0.27
58 0.27
59 0.26
60 0.26
61 0.23
62 0.21
63 0.21
64 0.15
65 0.14
66 0.13
67 0.15
68 0.15
69 0.21
70 0.27
71 0.34
72 0.41
73 0.46
74 0.49
75 0.53
76 0.59
77 0.59
78 0.58
79 0.56
80 0.53
81 0.5
82 0.46
83 0.39
84 0.32
85 0.25
86 0.19
87 0.13
88 0.11
89 0.11
90 0.14
91 0.22
92 0.22
93 0.25
94 0.28
95 0.29
96 0.3
97 0.37
98 0.37
99 0.36
100 0.36
101 0.4
102 0.4
103 0.42
104 0.4
105 0.38
106 0.36
107 0.32
108 0.35
109 0.29
110 0.3
111 0.26
112 0.24
113 0.18
114 0.17
115 0.2
116 0.18
117 0.19
118 0.16
119 0.16
120 0.19
121 0.22
122 0.23
123 0.19
124 0.19
125 0.2
126 0.21
127 0.21
128 0.22
129 0.23
130 0.23
131 0.23
132 0.22
133 0.2
134 0.18
135 0.18
136 0.14
137 0.12
138 0.09
139 0.09
140 0.1
141 0.1
142 0.1
143 0.13
144 0.15
145 0.15
146 0.15
147 0.14
148 0.12
149 0.13
150 0.13
151 0.1
152 0.1
153 0.12
154 0.16
155 0.19
156 0.2
157 0.2
158 0.19
159 0.21
160 0.2
161 0.18
162 0.16
163 0.15
164 0.17
165 0.2
166 0.22
167 0.21
168 0.23
169 0.22
170 0.2
171 0.2
172 0.2
173 0.17
174 0.15
175 0.15
176 0.14
177 0.18
178 0.19
179 0.24
180 0.26
181 0.26
182 0.26
183 0.26
184 0.25
185 0.23
186 0.24
187 0.19
188 0.19
189 0.21
190 0.22
191 0.25
192 0.32
193 0.38
194 0.45
195 0.52
196 0.51
197 0.53
198 0.53
199 0.54
200 0.56
201 0.52
202 0.45
203 0.39
204 0.35
205 0.37
206 0.36
207 0.31
208 0.26
209 0.22
210 0.25
211 0.32
212 0.38
213 0.37
214 0.45
215 0.47
216 0.47
217 0.47
218 0.47
219 0.42
220 0.41
221 0.44
222 0.45
223 0.49
224 0.49
225 0.52
226 0.53
227 0.56
228 0.57
229 0.6
230 0.6
231 0.63
232 0.69
233 0.76
234 0.82
235 0.88
236 0.92
237 0.92
238 0.91
239 0.9
240 0.88
241 0.83
242 0.77
243 0.76