Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RIS5

Protein Details
Accession A0A1E5RIS5   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-57NETKDLRRSKPYPAKRQPRQSTQKVEKHydrophilic
NLS Segment(s)
PositionSequence
38-70RRSKPYPAKRQPRQSTQKVEKIQQKRPVIKTEK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MSDNQSKTISFKEYLATKSKXSPKTPIQLTKNETKDLRRSKPYPAKRQPRQSTQKVEKIQQKRPVIKTEKVVKKERGXISSFRAYTPLDKNISIPRNRFNIKPGFFWDGVDRSTGFEKKFLKVDQELKLDKHKQKNDDGIDMEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.37
4 0.37
5 0.46
6 0.52
7 0.54
8 0.55
9 0.59
10 0.6
11 0.67
12 0.72
13 0.71
14 0.71
15 0.69
16 0.73
17 0.68
18 0.65
19 0.58
20 0.54
21 0.54
22 0.56
23 0.58
24 0.58
25 0.56
26 0.62
27 0.69
28 0.74
29 0.75
30 0.77
31 0.8
32 0.81
33 0.89
34 0.87
35 0.87
36 0.86
37 0.83
38 0.83
39 0.8
40 0.79
41 0.72
42 0.71
43 0.7
44 0.68
45 0.68
46 0.66
47 0.66
48 0.64
49 0.64
50 0.66
51 0.63
52 0.58
53 0.58
54 0.59
55 0.59
56 0.57
57 0.6
58 0.54
59 0.53
60 0.57
61 0.52
62 0.47
63 0.43
64 0.41
65 0.39
66 0.39
67 0.34
68 0.3
69 0.27
70 0.27
71 0.27
72 0.29
73 0.26
74 0.23
75 0.25
76 0.29
77 0.36
78 0.36
79 0.35
80 0.35
81 0.41
82 0.43
83 0.42
84 0.4
85 0.42
86 0.4
87 0.4
88 0.4
89 0.38
90 0.36
91 0.36
92 0.34
93 0.27
94 0.25
95 0.24
96 0.2
97 0.16
98 0.21
99 0.23
100 0.2
101 0.23
102 0.26
103 0.28
104 0.33
105 0.32
106 0.34
107 0.37
108 0.43
109 0.45
110 0.5
111 0.5
112 0.48
113 0.56
114 0.59
115 0.61
116 0.64
117 0.65
118 0.64
119 0.69
120 0.75
121 0.71
122 0.69