Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RCT5

Protein Details
Accession A0A1E5RCT5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-41AAMAGGKKSKKKWSKKSHKDRAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
16-34AMAGGKKSKKKWSKKSHKD
Subcellular Location(s) mito 13, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKQQLSKAQKAAAAMAGGKKSKKKWSKKSHKDRAQHAVILDQEKLDRILKEVPSYKYVSVSVLVDRLKLGGSLARVALKDLEARGMIKAVSKHSTQQIYVRASSTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.22
4 0.19
5 0.2
6 0.22
7 0.24
8 0.28
9 0.32
10 0.41
11 0.5
12 0.57
13 0.65
14 0.73
15 0.82
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.87
22 0.85
23 0.77
24 0.68
25 0.57
26 0.49
27 0.41
28 0.35
29 0.27
30 0.18
31 0.14
32 0.12
33 0.13
34 0.12
35 0.1
36 0.1
37 0.14
38 0.14
39 0.18
40 0.23
41 0.23
42 0.24
43 0.26
44 0.24
45 0.21
46 0.21
47 0.18
48 0.14
49 0.13
50 0.11
51 0.12
52 0.12
53 0.11
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.06
60 0.07
61 0.08
62 0.09
63 0.11
64 0.1
65 0.11
66 0.12
67 0.11
68 0.12
69 0.11
70 0.12
71 0.11
72 0.12
73 0.12
74 0.12
75 0.11
76 0.13
77 0.15
78 0.17
79 0.2
80 0.21
81 0.26
82 0.32
83 0.36
84 0.34
85 0.38
86 0.41
87 0.42
88 0.42