Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RTS8

Protein Details
Accession A0A1E5RTS8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-116YDNSKIRTKKTNSKKKNKKKEDKVDVKDREIKBasic
NLS Segment(s)
PositionSequence
90-130IRTKKTNSKKKNKKKEDKVDVKDREIKALMKELDKRENRKR
Subcellular Location(s) nucl 12, cyto_nucl 10.5, mito 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
Amino Acid Sequences MNNNKQVVIKSHSKIPVKILTESINYPVSVVTIKNKHNKGTLKSVVNNTLNVKVDDKIIKGNDIKYIVLPDIMRFNPLLNEVLEYDNSKIRTKKTNSKKKNKKKEDKVDVKDREIKALMKELDKRENRKRQIEDEAQGTKKQKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.52
4 0.47
5 0.47
6 0.42
7 0.37
8 0.36
9 0.35
10 0.32
11 0.26
12 0.22
13 0.2
14 0.17
15 0.14
16 0.12
17 0.12
18 0.16
19 0.21
20 0.27
21 0.36
22 0.39
23 0.41
24 0.47
25 0.53
26 0.51
27 0.54
28 0.54
29 0.51
30 0.53
31 0.53
32 0.54
33 0.48
34 0.46
35 0.38
36 0.36
37 0.31
38 0.28
39 0.25
40 0.18
41 0.2
42 0.19
43 0.18
44 0.18
45 0.17
46 0.19
47 0.19
48 0.2
49 0.2
50 0.2
51 0.19
52 0.15
53 0.16
54 0.13
55 0.12
56 0.11
57 0.09
58 0.11
59 0.11
60 0.11
61 0.1
62 0.1
63 0.09
64 0.11
65 0.11
66 0.08
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.12
74 0.14
75 0.17
76 0.18
77 0.21
78 0.29
79 0.35
80 0.44
81 0.52
82 0.62
83 0.69
84 0.79
85 0.87
86 0.89
87 0.94
88 0.95
89 0.95
90 0.95
91 0.95
92 0.95
93 0.95
94 0.92
95 0.91
96 0.85
97 0.8
98 0.77
99 0.67
100 0.6
101 0.52
102 0.45
103 0.37
104 0.4
105 0.36
106 0.33
107 0.39
108 0.4
109 0.48
110 0.53
111 0.59
112 0.62
113 0.7
114 0.73
115 0.76
116 0.77
117 0.74
118 0.76
119 0.76
120 0.69
121 0.66
122 0.65
123 0.58
124 0.58