Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RJU6

Protein Details
Accession A0A1E5RJU6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
189-215NDNFIKPASNIKKRRKLRNDNSESLENHydrophilic
NLS Segment(s)
PositionSequence
200-204KKRRK
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MPTRLHMAYNYSTPPDQVIQQDDIEIEDLQKDLIKKRLDCQNLSKNTVKADCLNSIDEYFKLEFNKESLKLIVVAGNNEDTTATPVENEYLSNMDHNQLFYSDLSSEESDLDTHLDFSEKYKRCIHSTPTPQVSYKSDSRKCSISSDLSVDTLISKQNYNENFLSSLQSYKTTNNLKSFQSFWQNCGYNDNFIKPASNIKKRRKLRNDNSESLENLPRLQSPILFSKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.24
4 0.24
5 0.26
6 0.24
7 0.24
8 0.24
9 0.22
10 0.2
11 0.19
12 0.15
13 0.11
14 0.09
15 0.09
16 0.08
17 0.11
18 0.12
19 0.15
20 0.22
21 0.28
22 0.29
23 0.36
24 0.45
25 0.49
26 0.51
27 0.57
28 0.59
29 0.6
30 0.64
31 0.62
32 0.54
33 0.53
34 0.5
35 0.43
36 0.37
37 0.34
38 0.32
39 0.29
40 0.29
41 0.26
42 0.25
43 0.24
44 0.19
45 0.19
46 0.17
47 0.16
48 0.15
49 0.15
50 0.15
51 0.16
52 0.21
53 0.18
54 0.19
55 0.18
56 0.17
57 0.17
58 0.16
59 0.17
60 0.13
61 0.13
62 0.12
63 0.12
64 0.11
65 0.1
66 0.1
67 0.07
68 0.09
69 0.09
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.08
76 0.06
77 0.07
78 0.07
79 0.08
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.08
86 0.09
87 0.08
88 0.09
89 0.07
90 0.07
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.07
97 0.07
98 0.07
99 0.05
100 0.06
101 0.05
102 0.06
103 0.05
104 0.08
105 0.17
106 0.18
107 0.21
108 0.26
109 0.29
110 0.32
111 0.36
112 0.4
113 0.4
114 0.47
115 0.51
116 0.5
117 0.5
118 0.47
119 0.45
120 0.42
121 0.37
122 0.36
123 0.38
124 0.39
125 0.4
126 0.42
127 0.43
128 0.41
129 0.4
130 0.38
131 0.31
132 0.27
133 0.27
134 0.25
135 0.22
136 0.2
137 0.17
138 0.14
139 0.11
140 0.11
141 0.09
142 0.09
143 0.1
144 0.16
145 0.18
146 0.22
147 0.22
148 0.21
149 0.22
150 0.22
151 0.24
152 0.18
153 0.19
154 0.15
155 0.16
156 0.16
157 0.16
158 0.23
159 0.27
160 0.32
161 0.36
162 0.39
163 0.39
164 0.4
165 0.42
166 0.39
167 0.43
168 0.39
169 0.35
170 0.4
171 0.41
172 0.38
173 0.42
174 0.39
175 0.34
176 0.35
177 0.36
178 0.29
179 0.27
180 0.28
181 0.23
182 0.31
183 0.35
184 0.43
185 0.5
186 0.6
187 0.7
188 0.77
189 0.87
190 0.88
191 0.9
192 0.9
193 0.92
194 0.9
195 0.87
196 0.85
197 0.77
198 0.68
199 0.61
200 0.55
201 0.45
202 0.37
203 0.31
204 0.26
205 0.26
206 0.25
207 0.22
208 0.21
209 0.3