Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5RU40

Protein Details
Accession A0A1E5RU40   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-60VIKTIKQQQKSNKKKNICFKNKCKKTANKFTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
Amino Acid Sequences MNAQPQDKELTLKDRTDSVSLADTNKVEVIKTIKQQQKSNKKKNICFKNKCKKTANKFTGSCQFCQNTYCTEHRLFEMHNCEQLNNAKKDLHKKNAEKLAKEQTTDNRVVNAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.3
4 0.28
5 0.23
6 0.22
7 0.22
8 0.22
9 0.21
10 0.18
11 0.17
12 0.19
13 0.17
14 0.12
15 0.14
16 0.17
17 0.19
18 0.23
19 0.32
20 0.35
21 0.41
22 0.47
23 0.55
24 0.62
25 0.69
26 0.75
27 0.75
28 0.78
29 0.8
30 0.84
31 0.85
32 0.84
33 0.83
34 0.84
35 0.86
36 0.85
37 0.85
38 0.84
39 0.82
40 0.81
41 0.82
42 0.78
43 0.74
44 0.68
45 0.64
46 0.65
47 0.57
48 0.48
49 0.41
50 0.36
51 0.28
52 0.28
53 0.25
54 0.19
55 0.21
56 0.22
57 0.22
58 0.22
59 0.23
60 0.22
61 0.23
62 0.21
63 0.22
64 0.27
65 0.25
66 0.27
67 0.27
68 0.26
69 0.28
70 0.34
71 0.37
72 0.32
73 0.33
74 0.32
75 0.36
76 0.46
77 0.52
78 0.54
79 0.56
80 0.6
81 0.67
82 0.74
83 0.76
84 0.7
85 0.68
86 0.69
87 0.62
88 0.58
89 0.54
90 0.52
91 0.53
92 0.53
93 0.47