Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E5RCN5

Protein Details
Accession A0A1E5RCN5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-34IPTAQPVKVKKLKQKKKKDPNAPKRGLSAHydrophilic
NLS Segment(s)
PositionSequence
13-30KVKKLKQKKKKDPNAPKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSDDQIPTAQPVKVKKLKQKKKKDPNAPKRGLSAYMIYANENRDRVRAENEGITFGQVGKKLGEEWKALTEEQKQKYKDLAEVEKKRYESEKALYLATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.62
4 0.72
5 0.78
6 0.85
7 0.87
8 0.9
9 0.94
10 0.94
11 0.95
12 0.95
13 0.95
14 0.9
15 0.81
16 0.74
17 0.65
18 0.56
19 0.46
20 0.36
21 0.27
22 0.24
23 0.22
24 0.19
25 0.18
26 0.18
27 0.19
28 0.18
29 0.17
30 0.14
31 0.16
32 0.16
33 0.19
34 0.18
35 0.17
36 0.19
37 0.18
38 0.19
39 0.17
40 0.16
41 0.12
42 0.1
43 0.11
44 0.09
45 0.09
46 0.08
47 0.08
48 0.1
49 0.13
50 0.15
51 0.15
52 0.15
53 0.18
54 0.19
55 0.19
56 0.2
57 0.26
58 0.32
59 0.37
60 0.43
61 0.41
62 0.42
63 0.46
64 0.45
65 0.41
66 0.4
67 0.44
68 0.47
69 0.54
70 0.57
71 0.59
72 0.58
73 0.56
74 0.53
75 0.48
76 0.44
77 0.41
78 0.42
79 0.38