Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E5R149

Protein Details
Accession A0A1E5R149   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
12-33RSYAYRPRRNVQYRDWNKQPLNHydrophilic
306-325STHPSSTKREQKFKEWLPKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.166, mito 10, cyto_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR001915  Peptidase_M48  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF01435  Peptidase_M48  
CDD cd07331  M48C_Oma1_like  
Amino Acid Sequences MNKFNXRFMLNXARSYAYRPRRNVQYRDWNKQPLNSVNSANSFGGIPAYFRNLTPSKKKNFMILGSLLAGFYVVNLEEVPISHRIRFSFIPHFLIKKIGDISYNSVFQQYGKDIKPENSRDTVKVRKIFNELLKTGLDFERGNEKVQLLRDLDWEVFVIADPGGSFMGPKESYPPNAFIVPNGKVFVFESLIKLCNNGDEDMLATVLAHELSHQLCGHSGESLSKSPLYFLLGITVYAATGLDFGRLLIDFGLKLPASRNMELEADYSGLLIMSQSCYNPNKSWMLWEKMNQFEKKQMGQRQSLEFLSTHPSSTKREQKFKEWLPKAQELYEHNDCSRLKSMSSDMMSYIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.52
4 0.52
5 0.59
6 0.68
7 0.73
8 0.78
9 0.78
10 0.79
11 0.79
12 0.82
13 0.82
14 0.81
15 0.74
16 0.72
17 0.7
18 0.66
19 0.63
20 0.57
21 0.52
22 0.47
23 0.46
24 0.44
25 0.36
26 0.29
27 0.23
28 0.19
29 0.18
30 0.13
31 0.12
32 0.1
33 0.15
34 0.15
35 0.15
36 0.22
37 0.25
38 0.32
39 0.41
40 0.48
41 0.51
42 0.58
43 0.6
44 0.6
45 0.61
46 0.56
47 0.52
48 0.45
49 0.39
50 0.32
51 0.31
52 0.23
53 0.17
54 0.14
55 0.08
56 0.06
57 0.05
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.06
64 0.08
65 0.13
66 0.15
67 0.16
68 0.18
69 0.19
70 0.23
71 0.24
72 0.27
73 0.3
74 0.31
75 0.34
76 0.35
77 0.36
78 0.32
79 0.35
80 0.3
81 0.25
82 0.24
83 0.2
84 0.2
85 0.2
86 0.24
87 0.22
88 0.23
89 0.2
90 0.19
91 0.18
92 0.16
93 0.17
94 0.15
95 0.19
96 0.18
97 0.22
98 0.23
99 0.29
100 0.37
101 0.39
102 0.4
103 0.4
104 0.42
105 0.42
106 0.46
107 0.49
108 0.47
109 0.48
110 0.46
111 0.43
112 0.46
113 0.49
114 0.48
115 0.46
116 0.39
117 0.35
118 0.33
119 0.3
120 0.27
121 0.22
122 0.18
123 0.12
124 0.12
125 0.18
126 0.19
127 0.2
128 0.19
129 0.19
130 0.19
131 0.21
132 0.23
133 0.16
134 0.16
135 0.16
136 0.17
137 0.16
138 0.14
139 0.13
140 0.09
141 0.07
142 0.06
143 0.05
144 0.04
145 0.04
146 0.03
147 0.04
148 0.04
149 0.04
150 0.04
151 0.03
152 0.07
153 0.07
154 0.07
155 0.11
156 0.12
157 0.15
158 0.17
159 0.19
160 0.17
161 0.19
162 0.19
163 0.16
164 0.19
165 0.18
166 0.17
167 0.15
168 0.14
169 0.12
170 0.13
171 0.13
172 0.1
173 0.09
174 0.09
175 0.1
176 0.12
177 0.11
178 0.11
179 0.1
180 0.1
181 0.11
182 0.1
183 0.09
184 0.08
185 0.08
186 0.08
187 0.08
188 0.06
189 0.04
190 0.04
191 0.04
192 0.04
193 0.03
194 0.03
195 0.05
196 0.05
197 0.07
198 0.07
199 0.07
200 0.08
201 0.1
202 0.1
203 0.09
204 0.09
205 0.09
206 0.12
207 0.13
208 0.13
209 0.13
210 0.12
211 0.12
212 0.12
213 0.13
214 0.11
215 0.1
216 0.11
217 0.11
218 0.11
219 0.1
220 0.1
221 0.07
222 0.06
223 0.06
224 0.03
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.05
231 0.05
232 0.06
233 0.05
234 0.06
235 0.05
236 0.06
237 0.09
238 0.08
239 0.09
240 0.1
241 0.17
242 0.22
243 0.23
244 0.23
245 0.22
246 0.23
247 0.24
248 0.22
249 0.16
250 0.12
251 0.11
252 0.09
253 0.07
254 0.06
255 0.05
256 0.05
257 0.04
258 0.06
259 0.07
260 0.07
261 0.12
262 0.15
263 0.2
264 0.21
265 0.25
266 0.27
267 0.26
268 0.35
269 0.37
270 0.4
271 0.4
272 0.44
273 0.47
274 0.51
275 0.59
276 0.54
277 0.49
278 0.5
279 0.51
280 0.52
281 0.54
282 0.54
283 0.53
284 0.57
285 0.6
286 0.58
287 0.56
288 0.5
289 0.43
290 0.36
291 0.3
292 0.3
293 0.25
294 0.22
295 0.21
296 0.23
297 0.27
298 0.37
299 0.45
300 0.48
301 0.58
302 0.62
303 0.68
304 0.75
305 0.79
306 0.8
307 0.77
308 0.75
309 0.73
310 0.75
311 0.69
312 0.61
313 0.57
314 0.5
315 0.52
316 0.51
317 0.47
318 0.4
319 0.43
320 0.41
321 0.41
322 0.43
323 0.37
324 0.3
325 0.31
326 0.35
327 0.36
328 0.38
329 0.34
330 0.3