Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RG83

Protein Details
Accession A0A1E4RG83    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22SERKRSTRKKKDPNAPKRSLSABasic
NLS Segment(s)
PositionSequence
3-17RKRSTRKKKDPNAPK
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences SERKRSTRKKKDPNAPKRSLSAYMFFANENRDIVRAENPGISFGQVGKLLGEKWKALGADEKVPYENKADADKKRYEKEKAEYAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.9
3 0.82
4 0.75
5 0.69
6 0.63
7 0.55
8 0.46
9 0.39
10 0.34
11 0.31
12 0.27
13 0.24
14 0.2
15 0.18
16 0.16
17 0.13
18 0.12
19 0.12
20 0.12
21 0.14
22 0.13
23 0.13
24 0.14
25 0.14
26 0.14
27 0.13
28 0.12
29 0.09
30 0.08
31 0.09
32 0.07
33 0.07
34 0.06
35 0.07
36 0.07
37 0.09
38 0.11
39 0.09
40 0.1
41 0.12
42 0.12
43 0.12
44 0.17
45 0.17
46 0.22
47 0.23
48 0.24
49 0.23
50 0.24
51 0.25
52 0.22
53 0.22
54 0.17
55 0.24
56 0.29
57 0.34
58 0.4
59 0.47
60 0.51
61 0.58
62 0.63
63 0.63
64 0.64
65 0.66
66 0.69