Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RFR5

Protein Details
Accession A0A1E4RFR5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-99TGLRTKTNTPKKASLKKLPRRIRHydrophilic
NLS Segment(s)
PositionSequence
86-99PKKASLKKLPRRIR
Subcellular Location(s) cysk 14, cyto 4, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEWIMVMYGSGDGAACLGWESHDANRLTLSTPTTSPSATLHSPSAQPVIGNLYIIHVWGSWCFPDSLIVLILLQSLTGLRTKTNTPKKASLKKLPRRIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.04
4 0.04
5 0.04
6 0.06
7 0.08
8 0.1
9 0.17
10 0.17
11 0.17
12 0.18
13 0.18
14 0.18
15 0.18
16 0.18
17 0.13
18 0.13
19 0.15
20 0.15
21 0.15
22 0.14
23 0.13
24 0.15
25 0.14
26 0.15
27 0.14
28 0.15
29 0.15
30 0.15
31 0.15
32 0.12
33 0.1
34 0.09
35 0.1
36 0.09
37 0.09
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.04
44 0.05
45 0.05
46 0.06
47 0.05
48 0.06
49 0.06
50 0.06
51 0.08
52 0.08
53 0.09
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.05
60 0.05
61 0.04
62 0.03
63 0.04
64 0.06
65 0.07
66 0.07
67 0.1
68 0.16
69 0.27
70 0.37
71 0.44
72 0.49
73 0.58
74 0.68
75 0.76
76 0.8
77 0.8
78 0.81
79 0.84